Target Information

Target General Infomation
Target ID
T55959
Former ID
TTDS00017
Target Name
Sodium-dependent dopamine transporter
Gene Name
SLC6A3
Synonyms
DA transporter; DAT; Dopamine transporter; SLC6A3
Target Type
Successful
Disease Attention deficit hyperactivity disorder [ICD9: 314; ICD10: F90]
Cocaine addiction [ICD9: 304.2; ICD10: F14.2]
Dementia [ICD9: 290-294; ICD10: F01-F07]
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32]
Mood disorder [ICD10: F30-F39]
Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89]
Narcolepsy [ICD9: 347; ICD10: G47.4]
Obesity [ICD9: 278; ICD10: E66]
Parkinson's disease [ICD9: 332; ICD10: G20]
Traumatic brain injury [ICD9: 800.0-801.9, 803.0-804.9, 850.0-854.1; ICD10: S06]
Function
Amine transporter. Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals.
BioChemical Class
Neurotransmitter:sodium symporter
Target Validation
T55959
UniProt ID
Q01959
Sequence
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
Drugs and Mode of Action
Drug(s) Altropane Drug Info Approved Attention deficit hyperactivity disorder [522203]
DEXMETHYLPHENIDATE HYDROCHLORIDE Drug Info Approved Attention deficit hyperactivity disorder [551871]
Ioflupane i-123 Drug Info Approved Parkinson's disease [531783]
Methylphenidate Drug Info Approved Attention deficit hyperactivity disorder [536713], [542252]
Modafinil Drug Info Approved Narcolepsy [551871]
Methylphenidate Drug Info Phase 4 Traumatic brain injury [536120], [542252]
Amitifadine Drug Info Phase 3 Obesity [527289], [528424]
Dasotraline Drug Info Phase 3 Mood disorder [524969], [543060]
NAV5001 Drug Info Phase 3 Dementia [524446]
Amfetamine transdermal Drug Info Phase 2 Attention deficit hyperactivity disorder [524098]
METHYLENEDIOXYMETHAMPHETAMINE Drug Info Phase 2 Discovery agent [521857]
GSK-1360707 Drug Info Phase 1 Major depressive disorder [523095]
RTI-336 Drug Info Phase 1 Cocaine addiction [536187]
Manifaxine Drug Info Discontinued in Phase 2 Major depressive disorder [546210]
NS-2389 Drug Info Discontinued in Phase 2 Major depressive disorder [546575]
SPD-473 Drug Info Discontinued in Phase 2 Mood disorder [546832]
KP106 Drug Info Discontinued in Phase 1 Attention deficit hyperactivity disorder [548965]
NSD-644 Drug Info Discontinued in Phase 1 Neurological disease [548670]
RG-7166 Drug Info Discontinued in Phase 1 Major depressive disorder [549027]
Vanoxerine Drug Info Discontinued in Phase 1 Cocaine addiction [536187]
Fluoratec Drug Info Terminated Attention deficit hyperactivity disorder [547430]
Seridopidine Drug Info Terminated Neurological disease [546992]
Inhibitor (+/-)-3-((naphthalen-2-yloxy)methyl)pyrrolidine Drug Info [530012]
(+/-)-threo-3',4'-Dichloromethylphenidate amide Drug Info [531163]
(+/-)-threo-3',4'-Dichlororitalinol Drug Info [531163]
(+/-)-threo-3',4'-Dichlororitalinol methyl ether Drug Info [531163]
(+/-)-threo-3',5'-Dichloromethylphenidate Drug Info [531163]
(+/-)-threo-3',5'-Dimethylmethylphenidate Drug Info [531163]
(+/-)-threo-3-Fluororitalinol Drug Info [531163]
(+/-)-threo-4'-Ethylmethylphenidate Drug Info [531163]
(+/-)-threo-Benzylphenidate Drug Info [531163]
(+/-)-threo-Methylphenidate amide Drug Info [531163]
(+/-)-threo-N-(2-Chlorobenzyl)methylphenidate Drug Info [531163]
(+/-)-threo-N-(2-Methylfuran)methylphenidate Drug Info [531163]
(+/-)-threo-N-(2-Methylpyridine)methylphenidate Drug Info [531163]
(+/-)-threo-N-(2-Methylthiopene)methylphenidate Drug Info [531163]
(+/-)-threo-N-(2-Phenylethyl)methylphenidate Drug Info [531163]
(+/-)-threo-N-(2-Phenylethyl)ritalinol Drug Info [531163]
(+/-)-threo-N-(3-Chlorobenzyl)methylphenidate Drug Info [531163]
(+/-)-threo-N-(3-Methylfuran)methylphenidate Drug Info [531163]
(+/-)-threo-N-(3-Methylpyridine)methylphenidate Drug Info [531163]
(+/-)-threo-N-(3-Methylthiopene)methylphenidate Drug Info [531163]
(+/-)-threo-N-(3-Phenylpropyl)methylphenidate Drug Info [531163]
(+/-)-threo-N-(3-Phenylpropyl)ritalinol Drug Info [531163]
(+/-)-threo-N-(4-Chlorobenzyl)methylphenidate Drug Info [531163]
(+/-)-threo-N-(4-Methoxybenzyl)methylphenidate Drug Info [531163]
(+/-)-threo-N-(4-Methylpyridine)methylphenidate Drug Info [531163]
(+/-)-threo-N-(4-Nitrobenzyl)methylphenidate Drug Info [531163]
(+/-)-threo-N-(4-Phenylbutyl)methylphenidate Drug Info [531163]
(+/-)-threo-N-(4-Phenylbutyl)ritalinol Drug Info [531163]
(+/-)-threo-N-(5-Phenylpentyl)methylphenidate Drug Info [531163]
(+/-)-threo-N-(6-Phenylhexyl)methylphenidate Drug Info [531163]
(+/-)-threo-N-Allylmethylphenidate Drug Info [531163]
(+/-)-threo-N-Benzyl-3',4'-dichlororitalinol Drug Info [531163]
(+/-)-threo-N-Benzyl-3'-chloromethylphenidate Drug Info [531163]
(+/-)-threo-N-Benzylmethylphenidate amide Drug Info [531163]
(+/-)-threo-N-Ethylritalinol Drug Info [531163]
(+/-)-threo-N-Methyl-30-methylmethylphenidate Drug Info [531163]
(+/-)-threo-N-Propargylmethylphenidate Drug Info [531163]
(+/-)-threo-Ritalinol Drug Info [531163]
(+/-)-threo-Ritalinol methyl ether Drug Info [531163]
(1-Phenyl-ethyl)-(2-phenyl-quinazolin-4-yl)-amine Drug Info [535513]
(2R,3R)-iodoreboxetine Drug Info [529666]
(2R,3S)-2-[(2-Iodophenoxy)phenylmethyl]morpholine Drug Info [530282]
(2R,3S)-2-[(3-Iodophenoxy)phenylmethyl]morpholine Drug Info [530282]
(2R,3S)-2-[(4-Iodophenoxy)phenylmethyl]morpholine Drug Info [530282]
(2S,3S)-2-(m-Tolyl)-3,5,5-trimethylmorpholin-2-ol Drug Info [530946]
(2S,3S)-2-Phenyl-3,5,5-trimethylmorpholin-2-ol Drug Info [530946]
(2S,3S)-iodoreboxetine Drug Info [529666]
(cis)-1,6-diphenyl-3-aza-bicyclo[3.1.0]hexane Drug Info [529523]
(R)-2-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol Drug Info [530918]
(R)-3-(naphthalen-2-ylmethoxy)pyrrolidine Drug Info [530012]
(R)-DULOXETINE Drug Info [529824]
(R)-N-isobutyl-N-(pyrrolidin-3-yl)-2-naphthamide Drug Info [530367]
(R)-Norfluoxetine Drug Info [529814]
(RS/SR)-2-[1-(3,4-dichlorophenyl)butyl]piperidine Drug Info [528619]
(RS/SR)-2-[1-(4-chlorophenyl)butyl]piperidine Drug Info [528619]
(RS/SR)-2-[1-(4-chlorophenyl)ethyl]piperidine Drug Info [528619]
(RS/SR)-2-[1-(4-chlorophenyl)hexyl]piperidine Drug Info [528619]
(RS/SR)-2-[1-(4-chlorophenyl)pentyl]piperidine Drug Info [528619]
(RS/SR)-2-[1-(4-chlorophenyl)propyl]piperidine Drug Info [528619]
(S)-3-(naphthalen-2-ylmethoxy)pyrrolidine Drug Info [530012]
(S)-Norfluoxetine Drug Info [529814]
1-(1,4-diphenylbutan-2-yl)piperazine Drug Info [528226]
1-(1-(4-FLUOROPHENYL)-2-(2-(TRIFLUOROMETHOXY)PHENYL)ETHYL)PIPERAZINE (ENANTIOMERIC MIX) Drug Info [530918]
1-(1-(benzo[b]thiophen-2-yl)cyclohexyl)piperidine Drug Info [529569]
1-(1-Benzo[b]thiophen-2-yl-cycloheptyl)-azepane Drug Info [533891]
1-(1-Benzo[b]thiophen-2-yl-cyclohexyl)-azepane Drug Info [533891]
1-(1-Benzo[b]thiophen-2-yl-cyclopentyl)-azepane Drug Info [533891]
1-(1-phenyl-2-(2-propoxyphenyl)ethyl)piperazine Drug Info [530918]
1-(2,3-Dihydro-1H-indol-5-ylmethyl)-propylamine Drug Info [533479]
1-(2-(2-(DIFLUOROMETHOXY)PHENYL)-1-PHENYLETHYL)PIPERAZINE (ENANTIOMERIC MIX) Drug Info [530918]
1-(2-(2-chlorophenyl)-1-phenylethyl)piperazine Drug Info [528224]
1-(2-(2-methoxyphenyl)-1-phenylethyl)piperazine Drug Info [528224]
1-(2-(4-fluorophenoxy)phenyl)piperazine Drug Info [530474]
1-(2-(phenoxymethyl)phenyl)piperazine Drug Info [530474]
1-(2-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one Drug Info [528036]
1-(2-phenoxyphenyl)piperazine Drug Info [530474]
1-(3,4-Dichloro-phenyl)-3-diethylamino-indan-5-ol Drug Info [527062]
1-(3,4-Dichloro-phenyl)-3-methylamino-indan-5-ol Drug Info [527062]
1-(3,4-dichlorophenyl)-3-aza-bicyclo[3.1.0]hexane Drug Info [529523]
1-(3-bromophenyl)-2-(tert-butylamino)propan-1-one Drug Info [530728]
1-(3-chlorophenyl)-2-(dimethylamino)propan-1-one Drug Info [530728]
1-(3-chlorophenyl)-2-(piperidin-1-yl)propan-1-one Drug Info [530728]
1-(3-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one Drug Info [528036]
1-(3-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one Drug Info [528036]
1-(4-aminophenyl)-2-pyrrolidin-1-yl-pentan-1-one Drug Info [530137]
1-(4-bromophenyl)-2-(tert-butylamino)propan-1-one Drug Info [530728]
1-(4-bromophenyl)-2-pyrrolidin-1-yl-pentan-1-one Drug Info [528036]
1-(4-fluorophenyl)-2-pyrrolidin-1-yl-pentan-1-one Drug Info [528036]
1-(4-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one Drug Info [528036]
1-(4-nitrophenyl)-2-pyrrolidin-1-yl-pentan-1-one Drug Info [528036]
1-(benzofuran-2-yl)-3-aza-bicyclo[3.1.0]hexane Drug Info [529523]
1-(naphthalen-2-yl)-3-aza-bicyclo[3.1.0]hexane Drug Info [529523]
1-(thiophen-2-yl)-3-aza-bicyclo[3.1.0]hexane Drug Info [529523]
1-Benzo[b]thiophen-2-yl-cycloheptylamine Drug Info [533891]
1-Benzo[b]thiophen-2-yl-cyclohexylamine Drug Info [533891]
1-Benzo[b]thiophen-2-yl-cyclopentylamine Drug Info [533891]
1-benzylpiperidine hydrochloride Drug Info [528826]
1-Biphenyl-4-yl-3-aza-bicyclo[3.1.0]hexane Drug Info [529523]
1-naphthalen-2-yl-2-pyrrolidin-1-yl-pentan-1-one Drug Info [528036]
1-phenyl-1-(piperidin-2-yl)propan-2-one Drug Info [528619]
1-phenyl-3-aza-bicyclo[3.1.0]hexane Drug Info [529523]
10R-hydroxylobel-7-ene Drug Info [528364]
10R-hydroxylobelane Drug Info [528364]
10S-hydroxylobel-7-ene Drug Info [528364]
10S-hydroxylobelane Drug Info [528364]
1S,2R-milnacipran Drug Info [529776]
2-((2-iodophenoxy)(phenyl)methyl)morpholine Drug Info [528517]
2-((3-iodophenyl)(o-tolyloxy)methyl)morpholine Drug Info [528517]
2-(2'-Aminoethyl)-5-benzyltetrahydrofuran Drug Info [529955]
2-(2,3-Dihydro-1H-indol-5-yl)-1-methyl-ethylamine Drug Info [533479]
2-(2-chlorophenoxy)-3-(piperidin-4-yl)pyridine Drug Info [530596]
2-(2-methoxyphenoxy)-3-(piperidin-4-yl)pyridine Drug Info [530596]
2-(Aminomethyl)-5-(1'-naphthyl)tetrahydrofuran Drug Info [529955]
2-(Aminomethyl)-5-(2'-naphthyl)tetrahydrofuran Drug Info [529955]
2-(Aminomethyl)-5-phenethyltetrahydrofuran Drug Info [529955]
2-(N,N-Diethylamino)-3'-chloropropiophenone Drug Info [530442]
2-(N-Cyclopentylamino)-3'-bromopropiophenone Drug Info [530728]
2-(N-Cyclopentylamino)-3'-chloropropiophenone Drug Info [530442]
2-(N-Cyclopentylamino)-3'-fluoropropiophenone Drug Info [530728]
2-(N-Cyclopentylamino)-3'-methoxypropiophenone Drug Info [530728]
2-(N-Cyclopentylamino)-3'-methylpropiophenone Drug Info [530728]
2-(N-Cyclopropylamino)-3-chloropropiophenone Drug Info [530442]
2-(N-Isopropylamino)-3'-chloropropiophenone Drug Info [530442]
2-(N-Pyrrolidinyl)-3'-bromopropiophenone Drug Info [530728]
2-(N-Pyrrolidinyl)-3'-fluoropropiophenone Drug Info [530728]
2-(N-Pyrrolidinyl)-3'-methoxypropiophenone Drug Info [530728]
2-(N-Pyrrolidinyl)-3'-methylpropiophenone Drug Info [530728]
2-(N-Pyrrolidinyl)-3'-nitropropiophenone Drug Info [530728]
2-(N-tert-Butylamino)-3',4'-dichloropropiophenone Drug Info [530442]
2-(N-tert-Butylamino)-3'-chloroheptanophenone Drug Info [530442]
2-(N-tert-Butylamino)-3'-chlorohexanophenone Drug Info [530442]
2-(N-tert-Butylamino)-3'-chlorooctanophenone Drug Info [530442]
2-(N-tert-Butylamino)-3'-chloropentanophenone Drug Info [530442]
2-(N-tert-Butylamino)-4'-chloropropiophenone Drug Info [530442]
2-(N-tert-Butylamino)propiophenone Drug Info [530442]
2-(tert-butylamino)-1-(3-chlorophenyl)butan-1-one Drug Info [530728]
2-(tert-butylamino)-1-m-tolylpropan-1-one Drug Info [530728]
2-(tert-butylamino)-1-p-tolylpropan-1-one Drug Info [530728]
2-(tert-Butylamino)-3',4'-dichlorobutyrophenone Drug Info [530442]
2-(tert-Butylamino)-3',4'-dichloropentanophenone Drug Info [530442]
2-(tert-Butylamino)-3',5'-difluoropropiophenone Drug Info [530442]
2-(tert-Butylamino)-3'-fluoropropiophenone Drug Info [530442]
2-Amino-1-(4-methylthiophenyl)propane Drug Info [530347]
2-Aminomethyl-5-(p-bromophenyl)tetrahydrofuran Drug Info [529955]
2-Aminomethyl-5-(p-chlorophenyl)tetrahydrofuran Drug Info [529955]
2-Aminomethyl-5-(p-methoxyphenyl)tetrahydrofuran Drug Info [529955]
2-Aminomethyl-5-(p-t-butylphenyl)tetrahydrofuran Drug Info [529955]
2-Aminomethyl-5-(phenyl)tetrahydrofuran Drug Info [529955]
2-phenoxy-3-(piperidin-4-yl)pyridine Drug Info [530596]
2-phenylpiperidine hydrochloride Drug Info [528826]
2pyrrolidin-1-yl-1-phenylpentan-1-one Drug Info [528036]
3-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol Drug Info [528224]
3-(3,4-dichlorophenyl)-2-nortropene Drug Info [530502]
3-(4-Chlorophenyl)-2-nortropene Drug Info [530502]
3-(4-Fluorophenyl)-2-nortropene Drug Info [530502]
3-(4-Trifluoromethylphenyl)-2-nortropene Drug Info [530502]
3-alpha-Phenylmethoxy-3-beta-phenyl-nortropane Drug Info [530502]
3-p-Tolyl-8-aza-bicyclo[3.2.1]octane Drug Info [525906]
3-Phenyl-2-nortropene Drug Info [530502]
3alpha-(bis-chloro-phenylmethoxy)tropane Drug Info [528473]
4-(1H-indol-3-yl)-N,N-dimethylcyclohex-3-enamine Drug Info [528760]
4-(2-((3-fluorophenoxy)methyl)phenyl)piperidine Drug Info [530474]
4-(2-(2-fluoro-5-methylphenoxy)phenyl)piperidine Drug Info [530474]
4-(2-(2-fluorobenzyloxy)phenyl)piperidine Drug Info [530474]
4-(2-(3-chlorophenoxy)phenyl)piperidine Drug Info [530474]
4-(2-(3-fluorophenoxy)-4-methylphenyl)piperidine Drug Info [530474]
4-(2-(3-fluorophenoxy)phenyl)piperidine Drug Info [530474]
4-(2-(4-fluorobenzyloxy)phenyl)piperidine Drug Info [530474]
4-(2-(4-fluorophenoxy)-4-methylphenyl)piperidine Drug Info [530474]
4-(2-(4-fluorophenoxy)phenyl)piperidine Drug Info [530474]
4-(2-(benzyloxy)-3-fluorophenyl)piperidine Drug Info [530474]
4-(2-(benzyloxy)-6-fluorophenyl)piperidine Drug Info [530474]
4-(2-(benzyloxy)phenyl)piperidine Drug Info [530474]
4-(2-(phenoxymethyl)phenyl)piperidine Drug Info [530474]
4-(2-fluoro-6-(2-fluorophenoxy)phenyl)piperidine Drug Info [530596]
4-(2-fluoro-6-(3-fluorophenoxy)phenyl)piperidine Drug Info [530474]
4-(2-fluoro-6-(4-fluorophenoxy)phenyl)piperidine Drug Info [530474]
4-(2-fluoro-6-phenoxyphenyl)piperidine Drug Info [530474]
4-(2-phenoxyphenyl)piperidine Drug Info [530474]
4-(2-pyrrolidin-1-yl-pentanoyl)benzonitrile Drug Info [528036]
4-(3-fluoro-2-phenoxyphenyl)piperidine Drug Info [530474]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one Drug Info [531079]
6-(3-aza-bicyclo[3.1.0]hexan-1-yl)quinoline Drug Info [529523]
6-(piperidin-4-ylmethoxy)-2-naphthonitrile Drug Info [530012]
7-(piperidin-4-ylmethoxy)-2-naphthonitrile Drug Info [530012]
8-Methyl-3-p-tolyl-8-aza-bicyclo[3.2.1]octane Drug Info [525906]
8R-hydroxylobel-9-ene Drug Info [530601]
8R-hydroxylobelane Drug Info [528364]
8S-hydroxylobel-9-ene Drug Info [528364]
8S-hydroxylobelane Drug Info [528364]
Altropane Drug Info [534626]
Amfetamine transdermal Drug Info [531141]
AMINOBENZTROPINE Drug Info [534349]
Amitifadine Drug Info [543975]
ANOLOBINE Drug Info [551362]
ANONAINE Drug Info [551362]
ANTIOQUINE Drug Info [551362]
Benzhydryl-(2-phenyl-quinazolin-4-yl)-amine Drug Info [535513]
Benzyl-(2-phenyl-quinazolin-4-yl)-amine Drug Info [535513]
Bip-tyr(3bzl)-thr-pro-lys-thr Drug Info [528289]
Bip-tyr-ala-pro-lys-thr(obzl)-gly Drug Info [528289]
Bip-tyr-thr-ala-pro-phe Drug Info [528289]
Bip-tyr-thr-pro-ala-thr(obzl)-gly Drug Info [528289]
Bip-tyr-thr-pro-lys-thr Drug Info [528289]
Bip-tyr-thr-pro-lys-thr(obzl)-gly Drug Info [528289]
Bip-tyr-thr-pro-thr(obzl)-gly Drug Info [528289]
Biphenyl-2-ylmethyl-(S)-pyrrolidin-3-yl-amine Drug Info [529592]
Cis-3-phenoxy-2,3-dihydro-1H-inden-1-amine Drug Info [529530]
COCAINE.HCL Drug Info [528826]
COCLAURINE Drug Info [551362]
compound 58 Drug Info [532887]
D-166A Drug Info [529287]
D-211A Drug Info [529287]
D-211B Drug Info [529287]
D-254C Drug Info [529287]
D-257A Drug Info [529287]
D-257C Drug Info [529287]
Dasotraline Drug Info [533235]
DEXMETHYLPHENIDATE HYDROCHLORIDE Drug Info [528826]
DIFLUOROBENZTROPINE Drug Info [528473]
DIMETHYLGRISABINE Drug Info [551362]
Erythro-3,4-dichloromethylphenidate hydrochloride Drug Info [528826]
GB-12819 Drug Info [526396]
GSK-1360707 Drug Info [532361]
HOMOAROMOLINE Drug Info [551362]
ISOPILINE Drug Info [551362]
ISOTETRANDRINE Drug Info [551362]
Methyl 2-(naphthalen-2-yl)benzoate Drug Info [528794]
METHYLENEDIOXYAMPHETAMINE Drug Info [530914]
METHYLENEDIOXYMETHAMPHETAMINE Drug Info [530347]
N,Ndimethyl milnacipran Drug Info [529263]
N-Benzylmethylphenidate Drug Info [531163]
NISOXETINE Drug Info [529530]
NORBOLDINE Drug Info [551362]
NORSTEPHALAGINE Drug Info [551362]
O-2442 Drug Info [543975]
O-methyldauricine Drug Info [551362]
OBABERINE Drug Info [551362]
Para-chloroamphetamine Drug Info [530347]
PF-18298 Drug Info [530918]
PF-3409409 Drug Info [530265]
PF-526014 Drug Info [530918]
PSEUDOCOCAINE Drug Info [525537]
PYROVALERONE Drug Info [530137]
R-226161 Drug Info [528772]
R-NORDULOXETINE Drug Info [530368]
RG-7166 Drug Info [549028]
RTI-219 Drug Info [528932]
SECOCULARIDINE Drug Info [551362]
SPD-473 Drug Info [527287]
Threo-1-aza-5-phenyl[4.4.0]decane hydrochloride Drug Info [528826]
Threo-3,4-dichlororitalinol hydrochloride Drug Info [528826]
Threo-N-ethylritalinol hydrochloride Drug Info [528826]
Threo-ritalinol hydrochloride Drug Info [528826]
Threo-ritalinol methyl ether hydrochloride Drug Info [528826]
Trans-3-(o-tolyloxy)-2,3-dihydro-1H-inden-1-amine Drug Info [529530]
WIN-35065 Drug Info [528932]
WIN-35065-2 Drug Info [534240]
WIN-35066-2 Drug Info [527309]
WIN_35428 Drug Info [534240]
[3-(3,4-Dichloro-phenyl)-indan-1-yl]-methyl-amine Drug Info [527062]
[3H]GBR12935 Drug Info [533984]
[3H]WIN35428 Drug Info [533984]
[N-[2-[(3'-N'-PROPYL-3''ALPHA-(BIS(4-FLUORORPHENYL)METHOXY)TROPANE-2''BETA-CARBOXYLIC ACID METHYL ESTER)(2-MERCAPTOETHYL)AMINO]ACETYL]-2-AMINOETHANETHIOLATO]RHENIUM(V) OXIDE (DIASTEREOMERIC MIX) Drug Info [534407]
Modulator 3,4-Methylenedioxymethamphetamine Drug Info [551382]
Fluoratec Drug Info [534375]
Ioflupane i-123 Drug Info [551871]
Manifaxine Drug Info [527845]
MMDA Drug Info [551393]
Modafinil Drug Info [556264]
NAV5001 Drug Info [534626]
NS-2389 Drug Info [550007]
RTI-336 Drug Info
Seridopidine Drug Info [533284]
Antagonist 4-Methoxyamphetamine Drug Info [551380]
Agonist KP106 Drug Info [551554]
Blocker Methylphenidate Drug Info [536100]
Vanoxerine Drug Info [536187]
Activator NSD-644 Drug Info [550360]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Dopaminergic synapse
Parkinson&#039
s disease
Cocaine addiction
Amphetamine addiction
Alcoholism
PANTHER Pathway Adrenaline and noradrenaline biosynthesis
Parkinson disease
Dopamine receptor mediated signaling pathway
Pathway Interaction Database Alpha-synuclein signaling
Reactome Na+/Cl- dependent neurotransmitter transporters
WikiPathways Monoamine Transport
NRF2 pathway
Dopaminergic Neurogenesis
Parkinsons Disease Pathway
Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds
Neurotransmitter Clearance In The Synaptic Cleft
References
Ref 521857ClinicalTrials.gov (NCT00353938) Study of 3,4-Methylenedioxymethamphetamine-assisted Psychotherapy in People With Posttraumatic Stress Disorder. U.S. National Institutes of Health.
Ref 522203ClinicalTrials.gov (NCT00596908) 123I-ALTROPANE Reference Image Acquisition in Subjects With Diagnostically Uncertain Tremor. U.S. National Institutes of Health.
Ref 523095ClinicalTrials.gov (NCT01153802) An Open Label Positron Emission Tomography Study in Healthy Male Subjects to Investigate Brain DAT and SERT Occupancy,Pharmacokinetics and Safety of Single Oral Dosesof GSK1360707, Using 11C- PE2I and 11C-DASB as PET Ligands. U.S. National Institutes of Health.
Ref 524098ClinicalTrials.gov (NCT01711021) Study to Evaluate Safety & Efficacy of d-Amphetamine Transdermal System Compared to Placebo in Children & Adolescents With ADHD. U.S. National Institutes of Health.
Ref 524446ClinicalTrials.gov (NCT01950455) Evaluation of the Diagnostic Efficacy and Safety of [123I]NAV5001 as an Imaging Agent to Aid in the Diagnosis of Parkinsonian Syndromes. U.S. National Institutes of Health.
Ref 524969ClinicalTrials.gov (NCT02276209) Dasotraline Adult ADHD Study. U.S. National Institutes of Health.
Ref 527289J Clin Pharmacol. 2004 Dec;44(12):1360-7.DOV 216,303, a "triple" reuptake inhibitor: safety, tolerability, and pharmacokinetic profile.
Ref 528424Preclinical and clinical pharmacology of DOV 216,303, a "triple" reuptake inhibitor. CNS Drug Rev. 2006 Summer;12(2):123-34.
Ref 5317832011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4.
Ref 536120Autism spectrum disorders: emerging pharmacotherapy. Expert Opin Emerg Drugs. 2005 Aug;10(3):521-36.
Ref 536187Emerging pharmacological strategies in the fight against cocaine addiction. Expert Opin Emerg Drugs. 2006 Mar;11(1):91-8.
Ref 536713Effects of methylphenidate on the catecholaminergic system in attention-deficit/hyperactivity disorder. J Clin Psychopharmacol. 2008 Jun;28(3 Suppl 2):S46-53.
Ref 542252(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7236).
Ref 543060(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8308).
Ref 546210Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006906)
Ref 546575Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009012)
Ref 546832Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010517)
Ref 546992Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011877)
Ref 547430Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016245)
Ref 548670Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027571)
Ref 548965Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030892)
Ref 549027Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031598)
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 525537Bioorg Med Chem Lett. 1999 Jul 5;9(13):1831-6.Synthesis of 8-Oxa analogues of norcocaine endowed with interesting cocaine-like activity.
Ref 525906Bioorg Med Chem Lett. 2000 Nov 6;10(21):2445-7.3alpha-(4-Substituted phenyl)nortropane-2beta-carboxylic acid methyl esters show selective binding at the norepinephrine transporter.
Ref 526396Bioorg Med Chem Lett. 2002 Sep 2;12(17):2387-90.Synthesis and dopamine transporter binding affinities of 3alpha-benzyl-8-(diarylmethoxyethyl)-8-azabicyclo[3.2.1]octanes.
Ref 527062J Med Chem. 2004 May 6;47(10):2624-34.Synthesis and pharmacological evaluation of 3-(3,4-dichlorophenyl)-1-indanamine derivatives as nonselective ligands for biogenic amine transporters.
Ref 527287Dopamine uptake inhibitor-induced rotation in 6-hydroxydopamine-lesioned rats involves both D1 and D2 receptors but is modulated through 5-hydroxytryptamine and noradrenaline receptors. J Pharmacol Exp Ther. 2005 Mar;312(3):1124-31. Epub 2004 Nov 12.
Ref 527309J Med Chem. 2004 Dec 2;47(25):6401-9.Monoamine transporter binding, locomotor activity, and drug discrimination properties of 3-(4-substituted-phenyl)tropane-2-carboxylic acid methyl ester isomers.
Ref 527845Pharmacogenetics and obesity: common gene variants influence weight loss response of the norepinephrine/dopamine transporter inhibitor GW320659 in obese subjects. Pharmacogenet Genomics. 2005 Dec;15(12):883-9.
Ref 528036J Med Chem. 2006 Feb 23;49(4):1420-32.1-(4-Methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one (Pyrovalerone) analogues: a promising class of monoamine uptake inhibitors.
Ref 528224Bioorg Med Chem Lett. 2006 Aug 15;16(16):4345-8. Epub 2006 Jun 5.N-(1,2-diphenylethyl)piperazines: a new class of dual serotonin/noradrenaline reuptake inhibitor.
Ref 528226Bioorg Med Chem Lett. 2006 Aug 15;16(16):4349-53. Epub 2006 Jun 5.Structure-activity relationships of N-substituted piperazine amine reuptake inhibitors.
Ref 528289J Med Chem. 2006 Jul 13;49(14):4048-51.Development of peptidic dopamine transporter inhibitors via aromatic modification-mediated conformational restriction.
Ref 528364Bioorg Med Chem Lett. 2006 Oct 1;16(19):5018-21. Epub 2006 Aug 14.Des-keto lobeline analogs with increased potency and selectivity at dopamine and serotonin transporters.
Ref 528473J Med Chem. 2006 Oct 19;49(21):6391-9.Structure-activity relationship studies on a novel series of (S)-2beta-substituted 3alpha-[bis(4-fluoro- or 4-chlorophenyl)methoxy]tropane analogues for in vivo investigation.
Ref 528517Bioorg Med Chem Lett. 2007 Jan 15;17(2):533-7. Epub 2006 Oct 12.Development of SPECT imaging agents for the norepinephrine transporters: [123I]INER.
Ref 528619J Med Chem. 2007 Jan 25;50(2):219-32.Slow-onset, long-duration, alkyl analogues of methylphenidate with enhanced selectivity for the dopamine transporter.
Ref 528760Bioorg Med Chem Lett. 2007 Jun 1;17(11):3099-104. Epub 2007 Mar 16.Conformationally restricted homotryptamines 3. Indole tetrahydropyridines and cyclohexenylamines as selective serotonin reuptake inhibitors.
Ref 528772Bioorg Med Chem. 2007 Jun 1;15(11):3649-60. Epub 2007 Mar 21.Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-adrenoceptor antagonism.
Ref 528794Bioorg Med Chem. 2007 Jun 15;15(12):4159-74. Epub 2007 Mar 30.Synthesis, inhibition and binding of simple non-nitrogen inhibitors of monoamine transporters.
Ref 528826J Med Chem. 2007 May 31;50(11):2718-31. Epub 2007 May 10.Synthesis and pharmacology of site-specific cocaine abuse treatment agents: restricted rotation analogues of methylphenidate.
Ref 528932J Med Chem. 2007 Jul 26;50(15):3686-95. Epub 2007 Jun 30.Synthesis, monoamine transporter binding, properties, and functional monoamine uptake activity of 3beta-[4-methylphenyl and 4-chlorophenyl]-2beta-[5-(substituted phenyl)thiazol-2-yl]tropanes.
Ref 529263Bioorg Med Chem Lett. 2008 Feb 15;18(4):1346-9. Epub 2008 Jan 9.Studies on the SAR and pharmacophore of milnacipran derivatives as monoamine transporter inhibitors.
Ref 529287Bioorg Med Chem. 2008 Mar 15;16(6):2769-78. Epub 2008 Jan 11.Further structural optimization of cis-(6-benzhydryl-piperidin-3-yl)-benzylamine and 1,4-diazabicyclo[3.3.1]nonane derivatives by introducing an exocyclic hydroxyl group: interaction with dopamine, serotonin, and norepinephrine transporters.
Ref 529523Bioorg Med Chem Lett. 2008 Jul 1;18(13):3682-6. Epub 2008 May 23.Studies on the structure-activity relationship of bicifadine analogs as monoamine transporter inhibitors.
Ref 529530Bioorg Med Chem Lett. 2008 Jul 15;18(14):4224-7. Epub 2008 May 20.Discovery of a potent, selective, and less flexible selective norepinephrine reuptake inhibitor (sNRI).
Ref 529569J Med Chem. 2008 Jul 24;51(14):4150-69. Epub 2008 Jun 28.Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity.
Ref 529592Bioorg Med Chem Lett. 2008 Aug 1;18(15):4355-9. Epub 2008 Jun 25.Derivatives of (3S)-N-(biphenyl-2-ylmethyl)pyrrolidin-3-amine as selective noradrenaline reuptake inhibitors: Reducing P-gp mediated efflux by modulation of H-bond acceptor capacity.
Ref 529666Bioorg Med Chem Lett. 2008 Sep 15;18(18):4940-3. Epub 2008 Aug 19.New iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter.
Ref 529776J Med Chem. 2008 Nov 27;51(22):7265-72.Characterization of thien-2-yl 1S,2R-milnacipran analogues as potent norepinephrine/serotonin transporter inhibitors for the treatment of neuropathic pain.
Ref 529814Bioorg Med Chem. 2009 Jan 1;17(1):337-43. Epub 2008 Nov 5.Stereoselective inhibition of serotonin re-uptake and phosphodiesterase by dual inhibitors as potential agents for depression.
Ref 529824Bioorg Med Chem Lett. 2009 Jan 1;19(1):58-61. Epub 2008 Nov 13.1-Naphthyl and 4-indolyl arylalkylamines as selective monoamine reuptake inhibitors.
Ref 529955Bioorg Med Chem. 2009 Mar 1;17(5):2047-68. Epub 2009 Jan 15.2,5-Disubstituted tetrahydrofurans as selective serotonin re-uptake inhibitors.
Ref 530012Bioorg Med Chem Lett. 2009 Apr 15;19(8):2329-32. Epub 2009 Feb 20.Design and optimization of selective serotonin re-uptake inhibitors with high synthetic accessibility. Part 1.
Ref 530137Bioorg Med Chem. 2009 Jun 1;17(11):3770-4. Epub 2009 May 3.A novel photoaffinity ligand for the dopamine transporter based on pyrovalerone.
Ref 530265Bioorg Med Chem Lett. 2009 Aug 15;19(16):4579-83. Epub 2009 Jul 2.Design, synthesis and evaluation of N-[(3S)-pyrrolidin-3-yl]benzamides as selective noradrenaline reuptake inhibitors: CNS penetration in a more polar template.
Ref 530282Bioorg Med Chem Lett. 2009 Sep 1;19(17):4996-8. Epub 2009 Jul 16.Design and synthesis of (2R,3S)-iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter.
Ref 530347Eur J Med Chem. 2009 Dec;44(12):4862-88. Epub 2009 Aug 6.Synthesis and serotonin transporter activity of sulphur-substituted alpha-alkyl phenethylamines as a new class of anticancer agents.
Ref 530367Bioorg Med Chem Lett. 2009 Oct 15;19(20):5893-7. Epub 2009 Aug 21.Design and optimisation of selective serotonin re-uptake inhibitors with high synthetic accessibility: part 2.
Ref 530368Bioorg Med Chem. 2009 Oct 1;17(19):6890-7. Epub 2009 Aug 20.Inhibition of serotonin and norepinephrine reuptake and inhibition of phosphodiesterase by multi-target inhibitors as potential agents fordepression.
Ref 530442J Med Chem. 2009 Nov 12;52(21):6768-81.Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for cocaine addiction.
Ref 530474Bioorg Med Chem Lett. 2009 Dec 1;19(23):6604-7. Epub 2009 Oct 12.Discovery and pharmacological characterization of aryl piperazine and piperidine ethers as dual acting norepinephrine reuptake inhibitors and 5-HT1A partial agonists.
Ref 530502Bioorg Med Chem Lett. 2009 Dec 15;19(24):6865-8. Epub 2009 Oct 23.Synthesis and monoamine transporter affinity of 3alpha-arylmethoxy-3beta-arylnortropanes.
Ref 530596Bioorg Med Chem Lett. 2010 Feb 1;20(3):1114-7. Epub 2009 Dec 6.Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agonists.
Ref 530601Bioorg Med Chem. 2010 Jan 15;18(2):640-9. Epub 2009 Dec 6.Lobeline esters as novel ligands for neuronal nicotinic acetylcholine receptors and neurotransmitter transporters.
Ref 530728J Med Chem. 2010 Mar 11;53(5):2204-14.Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for smoking cessation.
Ref 530914Bioorg Med Chem. 2010 Jun 1;18(11):4009-31. Epub 2010 Apr 13.Synthesis and in vitro toxicity of 4-MTA, its characteristic clandestine synthesis byproducts and related sulfur substituted alpha-alkylthioamphetamines.
Ref 530918Bioorg Med Chem Lett. 2010 Jun 15;20(12):3788-92. Epub 2010 Apr 18.Second generation N-(1,2-diphenylethyl)piperazines as dual serotonin and noradrenaline reuptake inhibitors: improving metabolic stability and reducing ion channel activity.
Ref 530946J Med Chem. 2010 Jun 24;53(12):4731-48.Synthesis and characterization of in vitro and in vivo profiles of hydroxybupropion analogues: aids to smoking cessation.
Ref 531079J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential.
Ref 531141Role of zinc in the pathogenesis of attention-deficit hyperactivity disorder: implications for research and treatment. CNS Drugs. 2010 Sep;24(9):721-8.
Ref 531163Bioorg Med Chem. 2010 Oct 15;18(20):7221-38. Epub 2010 Aug 19.Quantitative structure-activity relationship studies of threo-methylphenidate analogs.
Ref 532361Monoamine transporter occupancy of a novel triple reuptake inhibitor in baboons and humans using positron emission tomography. J Pharmacol Exp Ther. 2013 Aug;346(2):311-7.
Ref 532887Novel inhibitors of the high-affinity L-proline transporter as potential therapeutic agents for the treatment of cognitive disorders. Bioorg Med Chem Lett. 2014 Aug 15;24(16):3886-90.
Ref 533235Dasotraline for the Treatment of Attention-Deficit/Hyperactivity Disorder: A Randomized, Double-Blind, Placebo-Controlled, Proof-of-Concept Trial in Adults. Neuropsychopharmacology. 2015 Nov;40(12):2745-52.
Ref 533284Pridopidine selectively occupies sigma-1 rather than dopamine D2 receptors at behaviorally active doses. Psychopharmacology (Berl). 2015 Sep;232(18):3443-53.
Ref 533479J Med Chem. 1986 Aug;29(8):1406-12.Selective monoamine oxidase inhibitors. 3. Cyclic compounds related to 4-aminophenethylamine. Preparation and neuron-selective action of some 5-(2-aminoethyl)-2,3-dihydroindoles.
Ref 533891J Med Chem. 1993 Apr 30;36(9):1188-93.Synthesis and biological evaluation of 1-[1-(2-benzo[b]thienyl)cyclohexyl]piperidine homologues at dopamine-uptake and phencyclidine- and sigma-binding sites.
Ref 533984Pharmacological heterogeneity of the cloned and native human dopamine transporter: disassociation of [3H]WIN 35,428 and [3H]GBR 12,935 binding. Mol Pharmacol. 1994 Jan;45(1):125-35.
Ref 534240J Med Chem. 1996 Oct 11;39(21):4139-41.3 alpha-(4'-substituted phenyl)tropane-2 beta-carboxylic acid methyl esters: novel ligands with high affinity and selectivity at the dopamine transporter.
Ref 534349J Med Chem. 1997 Mar 14;40(6):851-7.3'-Chloro-3 alpha-(diphenylmethoxy)tropane but not 4'-chloro-3 alpha-(diphenylmethoxy)tropane produces a cocaine-like behavioral profile.
Ref 534375Technepine: a high-affinity 99m-technetium probe to label the dopamine transporter in brain by SPECT imaging. Synapse. 1996 Mar;22(3):239-46.
Ref 534407J Med Chem. 1997 Jun 6;40(12):1835-44.A technetium-99m SPECT imaging agent which targets the dopamine transporter in primate brain.
Ref 534626Rapid detection of Parkinson's disease by SPECT with altropane: a selective ligand for dopamine transporters. Synapse. 1998 Jun;29(2):128-41.
Ref 535513Identification of a novel partial inhibitor of dopamine transporter among 4-substituted 2-phenylquinazolines. Bioorg Med Chem Lett. 2002 Aug 19;12(16):2225-8.
Ref 536100Imaging the effects of methylphenidate on brain dopamine: new model on its therapeutic actions for attention-deficit/hyperactivity disorder. Biol Psychiatry. 2005 Jun 1;57(11):1410-5. Epub 2005 Jan 12.
Ref 536187Emerging pharmacological strategies in the fight against cocaine addiction. Expert Opin Emerg Drugs. 2006 Mar;11(1):91-8.
Ref 543975(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 927).
Ref 549028Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031598)
Ref 550007Clinical pipeline report, company report or official report of Neurosearch.
Ref 550360NSD-644: Phase I started.NeuroSearch A/S (CSE:NEUR), Ballerup, Denmark, GlaxoSmithKline plc (LSE:GSK; GSK), London, U.K.
Ref 551362Effects of various isoquinoline alkaloids on in vitro 3H-dopamine uptake by rat striatal synaptosomes. J Nat Prod. 1995 Oct;58(10):1475-84.
Ref 551380Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77.
Ref 551382The origin of <span class="caps">MDMA</span> (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
Ref 551554Treating Attention-Deficit/Hyperactivity Disorder in Adults: Focus on Once-Daily Medications. Prim Care Companion CNS Disord 2011.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.