Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T55959
|
||||
Former ID |
TTDS00017
|
||||
Target Name |
Sodium-dependent dopamine transporter
|
||||
Gene Name |
SLC6A3
|
||||
Synonyms |
DA transporter; DAT; Dopamine transporter; SLC6A3
|
||||
Target Type |
Successful
|
||||
Disease | Attention deficit hyperactivity disorder [ICD9: 314; ICD10: F90] | ||||
Cocaine addiction [ICD9: 304.2; ICD10: F14.2] | |||||
Dementia [ICD9: 290-294; ICD10: F01-F07] | |||||
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
Mood disorder [ICD10: F30-F39] | |||||
Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89] | |||||
Narcolepsy [ICD9: 347; ICD10: G47.4] | |||||
Obesity [ICD9: 278; ICD10: E66] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Traumatic brain injury [ICD9: 800.0-801.9, 803.0-804.9, 850.0-854.1; ICD10: S06] | |||||
Function |
Amine transporter. Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals.
|
||||
BioChemical Class |
Neurotransmitter:sodium symporter
|
||||
Target Validation |
T55959
|
||||
UniProt ID | |||||
Sequence |
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD RELVDRGEVRQFTLRHWLKV |
||||
Drugs and Mode of Action | |||||
Drug(s) | Altropane | Drug Info | Approved | Attention deficit hyperactivity disorder | [1] |
DEXMETHYLPHENIDATE HYDROCHLORIDE | Drug Info | Approved | Attention deficit hyperactivity disorder | [2] | |
Ioflupane i-123 | Drug Info | Approved | Parkinson's disease | [3] | |
Methylphenidate | Drug Info | Approved | Attention deficit hyperactivity disorder | [4], [5] | |
Modafinil | Drug Info | Approved | Narcolepsy | [2] | |
Methylphenidate | Drug Info | Phase 4 | Traumatic brain injury | [6], [5] | |
Amitifadine | Drug Info | Phase 3 | Obesity | [7], [8] | |
Dasotraline | Drug Info | Phase 3 | Mood disorder | [9], [10] | |
NAV5001 | Drug Info | Phase 3 | Dementia | [11] | |
Amfetamine transdermal | Drug Info | Phase 2 | Attention deficit hyperactivity disorder | [12] | |
METHYLENEDIOXYMETHAMPHETAMINE | Drug Info | Phase 2 | Discovery agent | [13] | |
GSK-1360707 | Drug Info | Phase 1 | Major depressive disorder | [14] | |
RTI-336 | Drug Info | Phase 1 | Cocaine addiction | [15] | |
Manifaxine | Drug Info | Discontinued in Phase 2 | Major depressive disorder | [16] | |
NS-2389 | Drug Info | Discontinued in Phase 2 | Major depressive disorder | [17] | |
SPD-473 | Drug Info | Discontinued in Phase 2 | Mood disorder | [18] | |
KP106 | Drug Info | Discontinued in Phase 1 | Attention deficit hyperactivity disorder | [19] | |
NSD-644 | Drug Info | Discontinued in Phase 1 | Neurological disease | [20] | |
RG-7166 | Drug Info | Discontinued in Phase 1 | Major depressive disorder | [21] | |
Vanoxerine | Drug Info | Discontinued in Phase 1 | Cocaine addiction | [15] | |
Fluoratec | Drug Info | Terminated | Attention deficit hyperactivity disorder | [22] | |
Seridopidine | Drug Info | Terminated | Neurological disease | [23] | |
Inhibitor | (+/-)-3-((naphthalen-2-yloxy)methyl)pyrrolidine | Drug Info | [24] | ||
(+/-)-threo-3',4'-Dichloromethylphenidate amide | Drug Info | [25] | |||
(+/-)-threo-3',4'-Dichlororitalinol | Drug Info | [25] | |||
(+/-)-threo-3',4'-Dichlororitalinol methyl ether | Drug Info | [25] | |||
(+/-)-threo-3',5'-Dichloromethylphenidate | Drug Info | [25] | |||
(+/-)-threo-3',5'-Dimethylmethylphenidate | Drug Info | [25] | |||
(+/-)-threo-3-Fluororitalinol | Drug Info | [25] | |||
(+/-)-threo-4'-Ethylmethylphenidate | Drug Info | [25] | |||
(+/-)-threo-Benzylphenidate | Drug Info | [25] | |||
(+/-)-threo-Methylphenidate amide | Drug Info | [25] | |||
(+/-)-threo-N-(2-Chlorobenzyl)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(2-Methylfuran)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(2-Methylpyridine)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(2-Methylthiopene)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(2-Phenylethyl)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(2-Phenylethyl)ritalinol | Drug Info | [25] | |||
(+/-)-threo-N-(3-Chlorobenzyl)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(3-Methylfuran)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(3-Methylpyridine)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(3-Methylthiopene)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(3-Phenylpropyl)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(3-Phenylpropyl)ritalinol | Drug Info | [25] | |||
(+/-)-threo-N-(4-Chlorobenzyl)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(4-Methoxybenzyl)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(4-Methylpyridine)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(4-Nitrobenzyl)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(4-Phenylbutyl)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(4-Phenylbutyl)ritalinol | Drug Info | [25] | |||
(+/-)-threo-N-(5-Phenylpentyl)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-(6-Phenylhexyl)methylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-Allylmethylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-Benzyl-3',4'-dichlororitalinol | Drug Info | [25] | |||
(+/-)-threo-N-Benzyl-3'-chloromethylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-Benzylmethylphenidate amide | Drug Info | [25] | |||
(+/-)-threo-N-Ethylritalinol | Drug Info | [25] | |||
(+/-)-threo-N-Methyl-30-methylmethylphenidate | Drug Info | [25] | |||
(+/-)-threo-N-Propargylmethylphenidate | Drug Info | [25] | |||
(+/-)-threo-Ritalinol | Drug Info | [25] | |||
(+/-)-threo-Ritalinol methyl ether | Drug Info | [25] | |||
(1-Phenyl-ethyl)-(2-phenyl-quinazolin-4-yl)-amine | Drug Info | [26] | |||
(2R,3R)-iodoreboxetine | Drug Info | [27] | |||
(2R,3S)-2-[(2-Iodophenoxy)phenylmethyl]morpholine | Drug Info | [28] | |||
(2R,3S)-2-[(3-Iodophenoxy)phenylmethyl]morpholine | Drug Info | [28] | |||
(2R,3S)-2-[(4-Iodophenoxy)phenylmethyl]morpholine | Drug Info | [28] | |||
(2S,3S)-2-(m-Tolyl)-3,5,5-trimethylmorpholin-2-ol | Drug Info | [29] | |||
(2S,3S)-2-Phenyl-3,5,5-trimethylmorpholin-2-ol | Drug Info | [29] | |||
(2S,3S)-iodoreboxetine | Drug Info | [27] | |||
(cis)-1,6-diphenyl-3-aza-bicyclo[3.1.0]hexane | Drug Info | [30] | |||
(R)-2-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol | Drug Info | [31] | |||
(R)-3-(naphthalen-2-ylmethoxy)pyrrolidine | Drug Info | [24] | |||
(R)-DULOXETINE | Drug Info | [32] | |||
(R)-N-isobutyl-N-(pyrrolidin-3-yl)-2-naphthamide | Drug Info | [33] | |||
(R)-Norfluoxetine | Drug Info | [34] | |||
(RS/SR)-2-[1-(3,4-dichlorophenyl)butyl]piperidine | Drug Info | [35] | |||
(RS/SR)-2-[1-(4-chlorophenyl)butyl]piperidine | Drug Info | [35] | |||
(RS/SR)-2-[1-(4-chlorophenyl)ethyl]piperidine | Drug Info | [35] | |||
(RS/SR)-2-[1-(4-chlorophenyl)hexyl]piperidine | Drug Info | [35] | |||
(RS/SR)-2-[1-(4-chlorophenyl)pentyl]piperidine | Drug Info | [35] | |||
(RS/SR)-2-[1-(4-chlorophenyl)propyl]piperidine | Drug Info | [35] | |||
(S)-3-(naphthalen-2-ylmethoxy)pyrrolidine | Drug Info | [24] | |||
(S)-Norfluoxetine | Drug Info | [34] | |||
1-(1,4-diphenylbutan-2-yl)piperazine | Drug Info | [36] | |||
1-(1-(4-FLUOROPHENYL)-2-(2-(TRIFLUOROMETHOXY)PHENYL)ETHYL)PIPERAZINE (ENANTIOMERIC MIX) | Drug Info | [31] | |||
1-(1-(benzo[b]thiophen-2-yl)cyclohexyl)piperidine | Drug Info | [37] | |||
1-(1-Benzo[b]thiophen-2-yl-cycloheptyl)-azepane | Drug Info | [38] | |||
1-(1-Benzo[b]thiophen-2-yl-cyclohexyl)-azepane | Drug Info | [38] | |||
1-(1-Benzo[b]thiophen-2-yl-cyclopentyl)-azepane | Drug Info | [38] | |||
1-(1-phenyl-2-(2-propoxyphenyl)ethyl)piperazine | Drug Info | [31] | |||
1-(2,3-Dihydro-1H-indol-5-ylmethyl)-propylamine | Drug Info | [39] | |||
1-(2-(2-(DIFLUOROMETHOXY)PHENYL)-1-PHENYLETHYL)PIPERAZINE (ENANTIOMERIC MIX) | Drug Info | [31] | |||
1-(2-(2-chlorophenyl)-1-phenylethyl)piperazine | Drug Info | [40] | |||
1-(2-(2-methoxyphenyl)-1-phenylethyl)piperazine | Drug Info | [40] | |||
1-(2-(4-fluorophenoxy)phenyl)piperazine | Drug Info | [41] | |||
1-(2-(phenoxymethyl)phenyl)piperazine | Drug Info | [41] | |||
1-(2-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [42] | |||
1-(2-phenoxyphenyl)piperazine | Drug Info | [41] | |||
1-(3,4-Dichloro-phenyl)-3-diethylamino-indan-5-ol | Drug Info | [43] | |||
1-(3,4-Dichloro-phenyl)-3-methylamino-indan-5-ol | Drug Info | [43] | |||
1-(3,4-dichlorophenyl)-3-aza-bicyclo[3.1.0]hexane | Drug Info | [30] | |||
1-(3-bromophenyl)-2-(tert-butylamino)propan-1-one | Drug Info | [44] | |||
1-(3-chlorophenyl)-2-(dimethylamino)propan-1-one | Drug Info | [44] | |||
1-(3-chlorophenyl)-2-(piperidin-1-yl)propan-1-one | Drug Info | [44] | |||
1-(3-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [42] | |||
1-(3-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [42] | |||
1-(4-aminophenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [45] | |||
1-(4-bromophenyl)-2-(tert-butylamino)propan-1-one | Drug Info | [44] | |||
1-(4-bromophenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [42] | |||
1-(4-fluorophenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [42] | |||
1-(4-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [42] | |||
1-(4-nitrophenyl)-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [42] | |||
1-(benzofuran-2-yl)-3-aza-bicyclo[3.1.0]hexane | Drug Info | [30] | |||
1-(naphthalen-2-yl)-3-aza-bicyclo[3.1.0]hexane | Drug Info | [30] | |||
1-(thiophen-2-yl)-3-aza-bicyclo[3.1.0]hexane | Drug Info | [30] | |||
1-Benzo[b]thiophen-2-yl-cycloheptylamine | Drug Info | [38] | |||
1-Benzo[b]thiophen-2-yl-cyclohexylamine | Drug Info | [38] | |||
1-Benzo[b]thiophen-2-yl-cyclopentylamine | Drug Info | [38] | |||
1-benzylpiperidine hydrochloride | Drug Info | [46] | |||
1-Biphenyl-4-yl-3-aza-bicyclo[3.1.0]hexane | Drug Info | [30] | |||
1-naphthalen-2-yl-2-pyrrolidin-1-yl-pentan-1-one | Drug Info | [42] | |||
1-phenyl-1-(piperidin-2-yl)propan-2-one | Drug Info | [35] | |||
1-phenyl-3-aza-bicyclo[3.1.0]hexane | Drug Info | [30] | |||
10R-hydroxylobel-7-ene | Drug Info | [47] | |||
10R-hydroxylobelane | Drug Info | [47] | |||
10S-hydroxylobel-7-ene | Drug Info | [47] | |||
10S-hydroxylobelane | Drug Info | [47] | |||
1S,2R-milnacipran | Drug Info | [48] | |||
2-((2-iodophenoxy)(phenyl)methyl)morpholine | Drug Info | [49] | |||
2-((3-iodophenyl)(o-tolyloxy)methyl)morpholine | Drug Info | [49] | |||
2-(2'-Aminoethyl)-5-benzyltetrahydrofuran | Drug Info | [50] | |||
2-(2,3-Dihydro-1H-indol-5-yl)-1-methyl-ethylamine | Drug Info | [39] | |||
2-(2-chlorophenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [51] | |||
2-(2-methoxyphenoxy)-3-(piperidin-4-yl)pyridine | Drug Info | [51] | |||
2-(Aminomethyl)-5-(1'-naphthyl)tetrahydrofuran | Drug Info | [50] | |||
2-(Aminomethyl)-5-(2'-naphthyl)tetrahydrofuran | Drug Info | [50] | |||
2-(Aminomethyl)-5-phenethyltetrahydrofuran | Drug Info | [50] | |||
2-(N,N-Diethylamino)-3'-chloropropiophenone | Drug Info | [52] | |||
2-(N-Cyclopentylamino)-3'-bromopropiophenone | Drug Info | [44] | |||
2-(N-Cyclopentylamino)-3'-chloropropiophenone | Drug Info | [52] | |||
2-(N-Cyclopentylamino)-3'-fluoropropiophenone | Drug Info | [44] | |||
2-(N-Cyclopentylamino)-3'-methoxypropiophenone | Drug Info | [44] | |||
2-(N-Cyclopentylamino)-3'-methylpropiophenone | Drug Info | [44] | |||
2-(N-Cyclopropylamino)-3-chloropropiophenone | Drug Info | [52] | |||
2-(N-Isopropylamino)-3'-chloropropiophenone | Drug Info | [52] | |||
2-(N-Pyrrolidinyl)-3'-bromopropiophenone | Drug Info | [44] | |||
2-(N-Pyrrolidinyl)-3'-fluoropropiophenone | Drug Info | [44] | |||
2-(N-Pyrrolidinyl)-3'-methoxypropiophenone | Drug Info | [44] | |||
2-(N-Pyrrolidinyl)-3'-methylpropiophenone | Drug Info | [44] | |||
2-(N-Pyrrolidinyl)-3'-nitropropiophenone | Drug Info | [44] | |||
2-(N-tert-Butylamino)-3',4'-dichloropropiophenone | Drug Info | [52] | |||
2-(N-tert-Butylamino)-3'-chloroheptanophenone | Drug Info | [52] | |||
2-(N-tert-Butylamino)-3'-chlorohexanophenone | Drug Info | [52] | |||
2-(N-tert-Butylamino)-3'-chlorooctanophenone | Drug Info | [52] | |||
2-(N-tert-Butylamino)-3'-chloropentanophenone | Drug Info | [52] | |||
2-(N-tert-Butylamino)-4'-chloropropiophenone | Drug Info | [52] | |||
2-(N-tert-Butylamino)propiophenone | Drug Info | [52] | |||
2-(tert-butylamino)-1-(3-chlorophenyl)butan-1-one | Drug Info | [44] | |||
2-(tert-butylamino)-1-m-tolylpropan-1-one | Drug Info | [44] | |||
2-(tert-butylamino)-1-p-tolylpropan-1-one | Drug Info | [44] | |||
2-(tert-Butylamino)-3',4'-dichlorobutyrophenone | Drug Info | [52] | |||
2-(tert-Butylamino)-3',4'-dichloropentanophenone | Drug Info | [52] | |||
2-(tert-Butylamino)-3',5'-difluoropropiophenone | Drug Info | [52] | |||
2-(tert-Butylamino)-3'-fluoropropiophenone | Drug Info | [52] | |||
2-Amino-1-(4-methylthiophenyl)propane | Drug Info | [53] | |||
2-Aminomethyl-5-(p-bromophenyl)tetrahydrofuran | Drug Info | [50] | |||
2-Aminomethyl-5-(p-chlorophenyl)tetrahydrofuran | Drug Info | [50] | |||
2-Aminomethyl-5-(p-methoxyphenyl)tetrahydrofuran | Drug Info | [50] | |||
2-Aminomethyl-5-(p-t-butylphenyl)tetrahydrofuran | Drug Info | [50] | |||
2-Aminomethyl-5-(phenyl)tetrahydrofuran | Drug Info | [50] | |||
2-phenoxy-3-(piperidin-4-yl)pyridine | Drug Info | [51] | |||
2-phenylpiperidine hydrochloride | Drug Info | [46] | |||
2pyrrolidin-1-yl-1-phenylpentan-1-one | Drug Info | [42] | |||
3-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol | Drug Info | [40] | |||
3-(3,4-dichlorophenyl)-2-nortropene | Drug Info | [54] | |||
3-(4-Chlorophenyl)-2-nortropene | Drug Info | [54] | |||
3-(4-Fluorophenyl)-2-nortropene | Drug Info | [54] | |||
3-(4-Trifluoromethylphenyl)-2-nortropene | Drug Info | [54] | |||
3-alpha-Phenylmethoxy-3-beta-phenyl-nortropane | Drug Info | [54] | |||
3-p-Tolyl-8-aza-bicyclo[3.2.1]octane | Drug Info | [55] | |||
3-Phenyl-2-nortropene | Drug Info | [54] | |||
3alpha-(bis-chloro-phenylmethoxy)tropane | Drug Info | [56] | |||
4-(1H-indol-3-yl)-N,N-dimethylcyclohex-3-enamine | Drug Info | [57] | |||
4-(2-((3-fluorophenoxy)methyl)phenyl)piperidine | Drug Info | [41] | |||
4-(2-(2-fluoro-5-methylphenoxy)phenyl)piperidine | Drug Info | [41] | |||
4-(2-(2-fluorobenzyloxy)phenyl)piperidine | Drug Info | [41] | |||
4-(2-(3-chlorophenoxy)phenyl)piperidine | Drug Info | [41] | |||
4-(2-(3-fluorophenoxy)-4-methylphenyl)piperidine | Drug Info | [41] | |||
4-(2-(3-fluorophenoxy)phenyl)piperidine | Drug Info | [41] | |||
4-(2-(4-fluorobenzyloxy)phenyl)piperidine | Drug Info | [41] | |||
4-(2-(4-fluorophenoxy)-4-methylphenyl)piperidine | Drug Info | [41] | |||
4-(2-(4-fluorophenoxy)phenyl)piperidine | Drug Info | [41] | |||
4-(2-(benzyloxy)-3-fluorophenyl)piperidine | Drug Info | [41] | |||
4-(2-(benzyloxy)-6-fluorophenyl)piperidine | Drug Info | [41] | |||
4-(2-(benzyloxy)phenyl)piperidine | Drug Info | [41] | |||
4-(2-(phenoxymethyl)phenyl)piperidine | Drug Info | [41] | |||
4-(2-fluoro-6-(2-fluorophenoxy)phenyl)piperidine | Drug Info | [51] | |||
4-(2-fluoro-6-(3-fluorophenoxy)phenyl)piperidine | Drug Info | [41] | |||
4-(2-fluoro-6-(4-fluorophenoxy)phenyl)piperidine | Drug Info | [41] | |||
4-(2-fluoro-6-phenoxyphenyl)piperidine | Drug Info | [41] | |||
4-(2-phenoxyphenyl)piperidine | Drug Info | [41] | |||
4-(2-pyrrolidin-1-yl-pentanoyl)benzonitrile | Drug Info | [42] | |||
4-(3-fluoro-2-phenoxyphenyl)piperidine | Drug Info | [41] | |||
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [58] | |||
6-(3-aza-bicyclo[3.1.0]hexan-1-yl)quinoline | Drug Info | [30] | |||
6-(piperidin-4-ylmethoxy)-2-naphthonitrile | Drug Info | [24] | |||
7-(piperidin-4-ylmethoxy)-2-naphthonitrile | Drug Info | [24] | |||
8-Methyl-3-p-tolyl-8-aza-bicyclo[3.2.1]octane | Drug Info | [55] | |||
8R-hydroxylobel-9-ene | Drug Info | [59] | |||
8R-hydroxylobelane | Drug Info | [47] | |||
8S-hydroxylobel-9-ene | Drug Info | [47] | |||
8S-hydroxylobelane | Drug Info | [47] | |||
Altropane | Drug Info | [60] | |||
Amfetamine transdermal | Drug Info | [61] | |||
AMINOBENZTROPINE | Drug Info | [62] | |||
Amitifadine | Drug Info | [63] | |||
ANOLOBINE | Drug Info | [64] | |||
ANONAINE | Drug Info | [64] | |||
ANTIOQUINE | Drug Info | [64] | |||
Benzhydryl-(2-phenyl-quinazolin-4-yl)-amine | Drug Info | [26] | |||
Benzyl-(2-phenyl-quinazolin-4-yl)-amine | Drug Info | [26] | |||
Bip-tyr(3bzl)-thr-pro-lys-thr | Drug Info | [65] | |||
Bip-tyr-ala-pro-lys-thr(obzl)-gly | Drug Info | [65] | |||
Bip-tyr-thr-ala-pro-phe | Drug Info | [65] | |||
Bip-tyr-thr-pro-ala-thr(obzl)-gly | Drug Info | [65] | |||
Bip-tyr-thr-pro-lys-thr | Drug Info | [65] | |||
Bip-tyr-thr-pro-lys-thr(obzl)-gly | Drug Info | [65] | |||
Bip-tyr-thr-pro-thr(obzl)-gly | Drug Info | [65] | |||
Biphenyl-2-ylmethyl-(S)-pyrrolidin-3-yl-amine | Drug Info | [66] | |||
Cis-3-phenoxy-2,3-dihydro-1H-inden-1-amine | Drug Info | [67] | |||
COCAINE.HCL | Drug Info | [46] | |||
COCLAURINE | Drug Info | [64] | |||
compound 58 | Drug Info | [68] | |||
D-166A | Drug Info | [69] | |||
D-211A | Drug Info | [69] | |||
D-211B | Drug Info | [69] | |||
D-254C | Drug Info | [69] | |||
D-257A | Drug Info | [69] | |||
D-257C | Drug Info | [69] | |||
Dasotraline | Drug Info | [70] | |||
DEXMETHYLPHENIDATE HYDROCHLORIDE | Drug Info | [46] | |||
DIFLUOROBENZTROPINE | Drug Info | [56] | |||
DIMETHYLGRISABINE | Drug Info | [64] | |||
Erythro-3,4-dichloromethylphenidate hydrochloride | Drug Info | [46] | |||
GB-12819 | Drug Info | [71] | |||
GSK-1360707 | Drug Info | [72] | |||
HOMOAROMOLINE | Drug Info | [64] | |||
ISOPILINE | Drug Info | [64] | |||
ISOTETRANDRINE | Drug Info | [64] | |||
Methyl 2-(naphthalen-2-yl)benzoate | Drug Info | [73] | |||
METHYLENEDIOXYAMPHETAMINE | Drug Info | [74] | |||
METHYLENEDIOXYMETHAMPHETAMINE | Drug Info | [53] | |||
N,Ndimethyl milnacipran | Drug Info | [75] | |||
N-Benzylmethylphenidate | Drug Info | [25] | |||
NISOXETINE | Drug Info | [67] | |||
NORBOLDINE | Drug Info | [64] | |||
NORSTEPHALAGINE | Drug Info | [64] | |||
O-2442 | Drug Info | [63] | |||
O-methyldauricine | Drug Info | [64] | |||
OBABERINE | Drug Info | [64] | |||
Para-chloroamphetamine | Drug Info | [53] | |||
PF-18298 | Drug Info | [31] | |||
PF-3409409 | Drug Info | [76] | |||
PF-526014 | Drug Info | [31] | |||
PSEUDOCOCAINE | Drug Info | [77] | |||
PYROVALERONE | Drug Info | [45] | |||
R-226161 | Drug Info | [78] | |||
R-NORDULOXETINE | Drug Info | [79] | |||
RG-7166 | Drug Info | [80] | |||
RTI-219 | Drug Info | [81] | |||
SECOCULARIDINE | Drug Info | [64] | |||
SPD-473 | Drug Info | [82] | |||
Threo-1-aza-5-phenyl[4.4.0]decane hydrochloride | Drug Info | [46] | |||
Threo-3,4-dichlororitalinol hydrochloride | Drug Info | [46] | |||
Threo-N-ethylritalinol hydrochloride | Drug Info | [46] | |||
Threo-ritalinol hydrochloride | Drug Info | [46] | |||
Threo-ritalinol methyl ether hydrochloride | Drug Info | [46] | |||
Trans-3-(o-tolyloxy)-2,3-dihydro-1H-inden-1-amine | Drug Info | [67] | |||
WIN-35065 | Drug Info | [81] | |||
WIN-35065-2 | Drug Info | [83] | |||
WIN-35066-2 | Drug Info | [84] | |||
WIN_35428 | Drug Info | [83] | |||
[3-(3,4-Dichloro-phenyl)-indan-1-yl]-methyl-amine | Drug Info | [43] | |||
[3H]GBR12935 | Drug Info | [85] | |||
[3H]WIN35428 | Drug Info | [85] | |||
[N-[2-[(3'-N'-PROPYL-3''ALPHA-(BIS(4-FLUORORPHENYL)METHOXY)TROPANE-2''BETA-CARBOXYLIC ACID METHYL ESTER)(2-MERCAPTOETHYL)AMINO]ACETYL]-2-AMINOETHANETHIOLATO]RHENIUM(V) OXIDE (DIASTEREOMERIC MIX) | Drug Info | [86] | |||
Modulator | 3,4-Methylenedioxymethamphetamine | Drug Info | [87] | ||
Fluoratec | Drug Info | [88] | |||
Ioflupane i-123 | Drug Info | [2] | |||
Manifaxine | Drug Info | [89] | |||
MMDA | Drug Info | [90] | |||
Modafinil | Drug Info | [91] | |||
NAV5001 | Drug Info | [60] | |||
NS-2389 | Drug Info | [92] | |||
RTI-336 | Drug Info | ||||
Seridopidine | Drug Info | [93] | |||
Antagonist | 4-Methoxyamphetamine | Drug Info | [94] | ||
Agonist | KP106 | Drug Info | [95] | ||
Blocker | Methylphenidate | Drug Info | [96] | ||
Vanoxerine | Drug Info | [15] | |||
Activator | NSD-644 | Drug Info | [97] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Dopaminergic synapse | ||||
Parkinson' | |||||
s disease | |||||
Cocaine addiction | |||||
Amphetamine addiction | |||||
Alcoholism | |||||
PANTHER Pathway | Adrenaline and noradrenaline biosynthesis | ||||
Parkinson disease | |||||
Dopamine receptor mediated signaling pathway | |||||
Pathway Interaction Database | Alpha-synuclein signaling | ||||
Reactome | Na+/Cl- dependent neurotransmitter transporters | ||||
WikiPathways | Monoamine Transport | ||||
NRF2 pathway | |||||
Dopaminergic Neurogenesis | |||||
Parkinsons Disease Pathway | |||||
Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds | |||||
Neurotransmitter Clearance In The Synaptic Cleft | |||||
References | |||||
REF 1 | ClinicalTrials.gov (NCT00596908) 123I-ALTROPANE Reference Image Acquisition in Subjects With Diagnostically Uncertain Tremor. U.S. National Institutes of Health. | ||||
REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 3 | 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4. | ||||
REF 4 | Effects of methylphenidate on the catecholaminergic system in attention-deficit/hyperactivity disorder. J Clin Psychopharmacol. 2008 Jun;28(3 Suppl 2):S46-53. | ||||
REF 5 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7236). | ||||
REF 6 | Autism spectrum disorders: emerging pharmacotherapy. Expert Opin Emerg Drugs. 2005 Aug;10(3):521-36. | ||||
REF 7 | J Clin Pharmacol. 2004 Dec;44(12):1360-7.DOV 216,303, a "triple" reuptake inhibitor: safety, tolerability, and pharmacokinetic profile. | ||||
REF 8 | Preclinical and clinical pharmacology of DOV 216,303, a "triple" reuptake inhibitor. CNS Drug Rev. 2006 Summer;12(2):123-34. | ||||
REF 9 | ClinicalTrials.gov (NCT02276209) Dasotraline Adult ADHD Study. U.S. National Institutes of Health. | ||||
REF 10 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8308). | ||||
REF 11 | ClinicalTrials.gov (NCT01950455) Evaluation of the Diagnostic Efficacy and Safety of [123I]NAV5001 as an Imaging Agent to Aid in the Diagnosis of Parkinsonian Syndromes. U.S. National Institutes of Health. | ||||
REF 12 | ClinicalTrials.gov (NCT01711021) Study to Evaluate Safety & Efficacy of d-Amphetamine Transdermal System Compared to Placebo in Children & Adolescents With ADHD. U.S. National Institutes of Health. | ||||
REF 13 | ClinicalTrials.gov (NCT00353938) Study of 3,4-Methylenedioxymethamphetamine-assisted Psychotherapy in People With Posttraumatic Stress Disorder. U.S. National Institutes of Health. | ||||
REF 14 | ClinicalTrials.gov (NCT01153802) An Open Label Positron Emission Tomography Study in Healthy Male Subjects to Investigate Brain DAT and SERT Occupancy,Pharmacokinetics and Safety of Single Oral Dosesof GSK1360707, Using 11C- PE2I and 11C-DASB as PET Ligands. U.S. National Institutes of Health. | ||||
REF 15 | Emerging pharmacological strategies in the fight against cocaine addiction. Expert Opin Emerg Drugs. 2006 Mar;11(1):91-8. | ||||
REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006906) | ||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009012) | ||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010517) | ||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030892) | ||||
REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027571) | ||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031598) | ||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016245) | ||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011877) | ||||
REF 24 | Bioorg Med Chem Lett. 2009 Apr 15;19(8):2329-32. Epub 2009 Feb 20.Design and optimization of selective serotonin re-uptake inhibitors with high synthetic accessibility. Part 1. | ||||
REF 25 | Bioorg Med Chem. 2010 Oct 15;18(20):7221-38. Epub 2010 Aug 19.Quantitative structure-activity relationship studies of threo-methylphenidate analogs. | ||||
REF 26 | Identification of a novel partial inhibitor of dopamine transporter among 4-substituted 2-phenylquinazolines. Bioorg Med Chem Lett. 2002 Aug 19;12(16):2225-8. | ||||
REF 27 | Bioorg Med Chem Lett. 2008 Sep 15;18(18):4940-3. Epub 2008 Aug 19.New iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. | ||||
REF 28 | Bioorg Med Chem Lett. 2009 Sep 1;19(17):4996-8. Epub 2009 Jul 16.Design and synthesis of (2R,3S)-iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. | ||||
REF 29 | J Med Chem. 2010 Jun 24;53(12):4731-48.Synthesis and characterization of in vitro and in vivo profiles of hydroxybupropion analogues: aids to smoking cessation. | ||||
REF 30 | Bioorg Med Chem Lett. 2008 Jul 1;18(13):3682-6. Epub 2008 May 23.Studies on the structure-activity relationship of bicifadine analogs as monoamine transporter inhibitors. | ||||
REF 31 | Bioorg Med Chem Lett. 2010 Jun 15;20(12):3788-92. Epub 2010 Apr 18.Second generation N-(1,2-diphenylethyl)piperazines as dual serotonin and noradrenaline reuptake inhibitors: improving metabolic stability and reducing ion channel activity. | ||||
REF 32 | Bioorg Med Chem Lett. 2009 Jan 1;19(1):58-61. Epub 2008 Nov 13.1-Naphthyl and 4-indolyl arylalkylamines as selective monoamine reuptake inhibitors. | ||||
REF 33 | Bioorg Med Chem Lett. 2009 Oct 15;19(20):5893-7. Epub 2009 Aug 21.Design and optimisation of selective serotonin re-uptake inhibitors with high synthetic accessibility: part 2. | ||||
REF 34 | Bioorg Med Chem. 2009 Jan 1;17(1):337-43. Epub 2008 Nov 5.Stereoselective inhibition of serotonin re-uptake and phosphodiesterase by dual inhibitors as potential agents for depression. | ||||
REF 35 | J Med Chem. 2007 Jan 25;50(2):219-32.Slow-onset, long-duration, alkyl analogues of methylphenidate with enhanced selectivity for the dopamine transporter. | ||||
REF 36 | Bioorg Med Chem Lett. 2006 Aug 15;16(16):4349-53. Epub 2006 Jun 5.Structure-activity relationships of N-substituted piperazine amine reuptake inhibitors. | ||||
REF 37 | J Med Chem. 2008 Jul 24;51(14):4150-69. Epub 2008 Jun 28.Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. | ||||
REF 38 | J Med Chem. 1993 Apr 30;36(9):1188-93.Synthesis and biological evaluation of 1-[1-(2-benzo[b]thienyl)cyclohexyl]piperidine homologues at dopamine-uptake and phencyclidine- and sigma-binding sites. | ||||
REF 39 | J Med Chem. 1986 Aug;29(8):1406-12.Selective monoamine oxidase inhibitors. 3. Cyclic compounds related to 4-aminophenethylamine. Preparation and neuron-selective action of some 5-(2-aminoethyl)-2,3-dihydroindoles. | ||||
REF 40 | Bioorg Med Chem Lett. 2006 Aug 15;16(16):4345-8. Epub 2006 Jun 5.N-(1,2-diphenylethyl)piperazines: a new class of dual serotonin/noradrenaline reuptake inhibitor. | ||||
REF 41 | Bioorg Med Chem Lett. 2009 Dec 1;19(23):6604-7. Epub 2009 Oct 12.Discovery and pharmacological characterization of aryl piperazine and piperidine ethers as dual acting norepinephrine reuptake inhibitors and 5-HT1A partial agonists. | ||||
REF 42 | J Med Chem. 2006 Feb 23;49(4):1420-32.1-(4-Methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one (Pyrovalerone) analogues: a promising class of monoamine uptake inhibitors. | ||||
REF 43 | J Med Chem. 2004 May 6;47(10):2624-34.Synthesis and pharmacological evaluation of 3-(3,4-dichlorophenyl)-1-indanamine derivatives as nonselective ligands for biogenic amine transporters. | ||||
REF 44 | J Med Chem. 2010 Mar 11;53(5):2204-14.Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for smoking cessation. | ||||
REF 45 | Bioorg Med Chem. 2009 Jun 1;17(11):3770-4. Epub 2009 May 3.A novel photoaffinity ligand for the dopamine transporter based on pyrovalerone. | ||||
REF 46 | J Med Chem. 2007 May 31;50(11):2718-31. Epub 2007 May 10.Synthesis and pharmacology of site-specific cocaine abuse treatment agents: restricted rotation analogues of methylphenidate. | ||||
REF 47 | Bioorg Med Chem Lett. 2006 Oct 1;16(19):5018-21. Epub 2006 Aug 14.Des-keto lobeline analogs with increased potency and selectivity at dopamine and serotonin transporters. | ||||
REF 48 | J Med Chem. 2008 Nov 27;51(22):7265-72.Characterization of thien-2-yl 1S,2R-milnacipran analogues as potent norepinephrine/serotonin transporter inhibitors for the treatment of neuropathic pain. | ||||
REF 49 | Bioorg Med Chem Lett. 2007 Jan 15;17(2):533-7. Epub 2006 Oct 12.Development of SPECT imaging agents for the norepinephrine transporters: [123I]INER. | ||||
REF 50 | Bioorg Med Chem. 2009 Mar 1;17(5):2047-68. Epub 2009 Jan 15.2,5-Disubstituted tetrahydrofurans as selective serotonin re-uptake inhibitors. | ||||
REF 51 | Bioorg Med Chem Lett. 2010 Feb 1;20(3):1114-7. Epub 2009 Dec 6.Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agonists. | ||||
REF 52 | J Med Chem. 2009 Nov 12;52(21):6768-81.Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for cocaine addiction. | ||||
REF 53 | Eur J Med Chem. 2009 Dec;44(12):4862-88. Epub 2009 Aug 6.Synthesis and serotonin transporter activity of sulphur-substituted alpha-alkyl phenethylamines as a new class of anticancer agents. | ||||
REF 54 | Bioorg Med Chem Lett. 2009 Dec 15;19(24):6865-8. Epub 2009 Oct 23.Synthesis and monoamine transporter affinity of 3alpha-arylmethoxy-3beta-arylnortropanes. | ||||
REF 55 | Bioorg Med Chem Lett. 2000 Nov 6;10(21):2445-7.3alpha-(4-Substituted phenyl)nortropane-2beta-carboxylic acid methyl esters show selective binding at the norepinephrine transporter. | ||||
REF 56 | J Med Chem. 2006 Oct 19;49(21):6391-9.Structure-activity relationship studies on a novel series of (S)-2beta-substituted 3alpha-[bis(4-fluoro- or 4-chlorophenyl)methoxy]tropane analogues for in vivo investigation. | ||||
REF 57 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3099-104. Epub 2007 Mar 16.Conformationally restricted homotryptamines 3. Indole tetrahydropyridines and cyclohexenylamines as selective serotonin reuptake inhibitors. | ||||
REF 58 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
REF 59 | Bioorg Med Chem. 2010 Jan 15;18(2):640-9. Epub 2009 Dec 6.Lobeline esters as novel ligands for neuronal nicotinic acetylcholine receptors and neurotransmitter transporters. | ||||
REF 60 | Rapid detection of Parkinson's disease by SPECT with altropane: a selective ligand for dopamine transporters. Synapse. 1998 Jun;29(2):128-41. | ||||
REF 61 | Role of zinc in the pathogenesis of attention-deficit hyperactivity disorder: implications for research and treatment. CNS Drugs. 2010 Sep;24(9):721-8. | ||||
REF 62 | J Med Chem. 1997 Mar 14;40(6):851-7.3'-Chloro-3 alpha-(diphenylmethoxy)tropane but not 4'-chloro-3 alpha-(diphenylmethoxy)tropane produces a cocaine-like behavioral profile. | ||||
REF 63 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 927). | ||||
REF 64 | Effects of various isoquinoline alkaloids on in vitro 3H-dopamine uptake by rat striatal synaptosomes. J Nat Prod. 1995 Oct;58(10):1475-84. | ||||
REF 65 | J Med Chem. 2006 Jul 13;49(14):4048-51.Development of peptidic dopamine transporter inhibitors via aromatic modification-mediated conformational restriction. | ||||
REF 66 | Bioorg Med Chem Lett. 2008 Aug 1;18(15):4355-9. Epub 2008 Jun 25.Derivatives of (3S)-N-(biphenyl-2-ylmethyl)pyrrolidin-3-amine as selective noradrenaline reuptake inhibitors: Reducing P-gp mediated efflux by modulation of H-bond acceptor capacity. | ||||
REF 67 | Bioorg Med Chem Lett. 2008 Jul 15;18(14):4224-7. Epub 2008 May 20.Discovery of a potent, selective, and less flexible selective norepinephrine reuptake inhibitor (sNRI). | ||||
REF 68 | Novel inhibitors of the high-affinity L-proline transporter as potential therapeutic agents for the treatment of cognitive disorders. Bioorg Med Chem Lett. 2014 Aug 15;24(16):3886-90. | ||||
REF 69 | Bioorg Med Chem. 2008 Mar 15;16(6):2769-78. Epub 2008 Jan 11.Further structural optimization of cis-(6-benzhydryl-piperidin-3-yl)-benzylamine and 1,4-diazabicyclo[3.3.1]nonane derivatives by introducing an exocyclic hydroxyl group: interaction with dopamine, serotonin, and norepinephrine transporters. | ||||
REF 70 | Dasotraline for the Treatment of Attention-Deficit/Hyperactivity Disorder: A Randomized, Double-Blind, Placebo-Controlled, Proof-of-Concept Trial in Adults. Neuropsychopharmacology. 2015 Nov;40(12):2745-52. | ||||
REF 71 | Bioorg Med Chem Lett. 2002 Sep 2;12(17):2387-90.Synthesis and dopamine transporter binding affinities of 3alpha-benzyl-8-(diarylmethoxyethyl)-8-azabicyclo[3.2.1]octanes. | ||||
REF 72 | Monoamine transporter occupancy of a novel triple reuptake inhibitor in baboons and humans using positron emission tomography. J Pharmacol Exp Ther. 2013 Aug;346(2):311-7. | ||||
REF 73 | Bioorg Med Chem. 2007 Jun 15;15(12):4159-74. Epub 2007 Mar 30.Synthesis, inhibition and binding of simple non-nitrogen inhibitors of monoamine transporters. | ||||
REF 74 | Bioorg Med Chem. 2010 Jun 1;18(11):4009-31. Epub 2010 Apr 13.Synthesis and in vitro toxicity of 4-MTA, its characteristic clandestine synthesis byproducts and related sulfur substituted alpha-alkylthioamphetamines. | ||||
REF 75 | Bioorg Med Chem Lett. 2008 Feb 15;18(4):1346-9. Epub 2008 Jan 9.Studies on the SAR and pharmacophore of milnacipran derivatives as monoamine transporter inhibitors. | ||||
REF 76 | Bioorg Med Chem Lett. 2009 Aug 15;19(16):4579-83. Epub 2009 Jul 2.Design, synthesis and evaluation of N-[(3S)-pyrrolidin-3-yl]benzamides as selective noradrenaline reuptake inhibitors: CNS penetration in a more polar template. | ||||
REF 77 | Bioorg Med Chem Lett. 1999 Jul 5;9(13):1831-6.Synthesis of 8-Oxa analogues of norcocaine endowed with interesting cocaine-like activity. | ||||
REF 78 | Bioorg Med Chem. 2007 Jun 1;15(11):3649-60. Epub 2007 Mar 21.Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-adrenoceptor antagonism. | ||||
REF 79 | Bioorg Med Chem. 2009 Oct 1;17(19):6890-7. Epub 2009 Aug 20.Inhibition of serotonin and norepinephrine reuptake and inhibition of phosphodiesterase by multi-target inhibitors as potential agents fordepression. | ||||
REF 80 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031598) | ||||
REF 81 | J Med Chem. 2007 Jul 26;50(15):3686-95. Epub 2007 Jun 30.Synthesis, monoamine transporter binding, properties, and functional monoamine uptake activity of 3beta-[4-methylphenyl and 4-chlorophenyl]-2beta-[5-(substituted phenyl)thiazol-2-yl]tropanes. | ||||
REF 82 | Dopamine uptake inhibitor-induced rotation in 6-hydroxydopamine-lesioned rats involves both D1 and D2 receptors but is modulated through 5-hydroxytryptamine and noradrenaline receptors. J Pharmacol Exp Ther. 2005 Mar;312(3):1124-31. Epub 2004 Nov 12. | ||||
REF 83 | J Med Chem. 1996 Oct 11;39(21):4139-41.3 alpha-(4'-substituted phenyl)tropane-2 beta-carboxylic acid methyl esters: novel ligands with high affinity and selectivity at the dopamine transporter. | ||||
REF 84 | J Med Chem. 2004 Dec 2;47(25):6401-9.Monoamine transporter binding, locomotor activity, and drug discrimination properties of 3-(4-substituted-phenyl)tropane-2-carboxylic acid methyl ester isomers. | ||||
REF 85 | Pharmacological heterogeneity of the cloned and native human dopamine transporter: disassociation of [3H]WIN 35,428 and [3H]GBR 12,935 binding. Mol Pharmacol. 1994 Jan;45(1):125-35. | ||||
REF 86 | J Med Chem. 1997 Jun 6;40(12):1835-44.A technetium-99m SPECT imaging agent which targets the dopamine transporter in primate brain. | ||||
REF 87 | The origin of <span class="caps">MDMA</span> (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5. | ||||
REF 88 | Technepine: a high-affinity 99m-technetium probe to label the dopamine transporter in brain by SPECT imaging. Synapse. 1996 Mar;22(3):239-46. | ||||
REF 89 | Pharmacogenetics and obesity: common gene variants influence weight loss response of the norepinephrine/dopamine transporter inhibitor GW320659 in obese subjects. Pharmacogenet Genomics. 2005 Dec;15(12):883-9. | ||||
REF 90 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 91 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | ||||
REF 92 | Clinical pipeline report, company report or official report of Neurosearch. | ||||
REF 93 | Pridopidine selectively occupies sigma-1 rather than dopamine D2 receptors at behaviorally active doses. Psychopharmacology (Berl). 2015 Sep;232(18):3443-53. | ||||
REF 94 | Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77. | ||||
REF 95 | Treating Attention-Deficit/Hyperactivity Disorder in Adults: Focus on Once-Daily Medications. Prim Care Companion CNS Disord 2011. | ||||
REF 96 | Imaging the effects of methylphenidate on brain dopamine: new model on its therapeutic actions for attention-deficit/hyperactivity disorder. Biol Psychiatry. 2005 Jun 1;57(11):1410-5. Epub 2005 Jan 12. | ||||
REF 97 | NSD-644: Phase I started.NeuroSearch A/S (CSE:NEUR), Ballerup, Denmark, GlaxoSmithKline plc (LSE:GSK; GSK), London, U.K. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.