Target General Infomation
Target ID
T99347
Former ID
TTDC00100
Target Name
Metabotropic glutamate receptor 5
Gene Name
GRM5
Synonyms
5b; Glutamate receptor mGLU5; mGluR5; GRM5
Target Type
Clinical Trial
Disease Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42]
Autism [ICD9: 299; ICD10: F84.0]
Alzheimer disease [ICD9: 331; ICD10: G30]
Central nervous system disease [ICD10: G00-G99]
Chronic neuropathic pain [ICD9: 338, 356.0, 356.8, 530,780; ICD10: G64, G90.0, K21, R52, G89]
Fragile X syndrome [ICD9: 332, 759.83; ICD10: F02.3, G20, Q99.2]
Major depressive disorder; GERD; Chronic neuropathic pain [ICD9: 296.2, 296.3, 338, 356.0, 356.8, 530,780; ICD10: F32, F33, G64, G90.0, K21, R52, G89]
Mood disorder [ICD10: F30-F39]
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32]
Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89]
Neuropathic pain; Migraine [ICD9: 338, 346,780; ICD10: G43, R52, G89]
Unspecified [ICD code not available]
Function
G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling activates a phosphatidylinositol-calcium second messenger system and generates a calcium-activated chloride current. Plays an important role in the regulation of synaptic plasticity and the modulation of the neural network activity.
BioChemical Class
GPCR glutamate
Target Validation
T99347
UniProt ID
Sequence
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ
HRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGAGAGGSAGGVGATGGAGCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPS
PISTLSHRAGSASRTDDDVPSLHSEPVARSSSSQGSLMEQISSVVTRFTANISELNSMML
STAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAA
RESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL
IIRDYTQSSSSL
Drugs and Mode of Action
Drug(s) AFQ056 Drug Info Phase 2/3 Fragile X syndrome [1], [2]
ADX-48621 Drug Info Phase 2 Mood disorder [3], [4]
ADX10059 Drug Info Phase 2 Anxiety disorder [5]
RG-7090 Drug Info Phase 2 Fragile X syndrome [6]
STX-107 Drug Info Phase 2 Autism [7], [8]
McN3377 Drug Info Phase 1/2 Fragile X syndrome [9], [10]
MK-3328 Drug Info Phase 1 Alzheimer disease [11]
AZD2066 Drug Info Discontinued in Phase 2 Major depressive disorder; GERD; Chronic neuropathic pain [12]
AZD2516 Drug Info Discontinued in Phase 2 Chronic neuropathic pain [13]
LY467711 Drug Info Terminated Neuropathic pain; Migraine [14]
LY525327 Drug Info Terminated Neuropathic pain; Migraine [14]
Antagonist (+)-MCPG Drug Info [15]
(S)-4C3HPG Drug Info [15]
(S)-4CPG Drug Info [15]
ACDPP Drug Info [16]
AZD2066 Drug Info [17]
AZD2516 Drug Info [17]
CTEP Drug Info [18]
GSK-2210875 Drug Info [18]
LY467711 Drug Info [19]
LY525327 Drug Info [19]
MGluR5 antagonists (anxiety), Novartis Drug Info [18]
RG-7090 Drug Info [20]
RTI-4229-982 Drug Info [18]
STX-107 Drug Info [21]
Agonist (1S,3R)-ACPD Drug Info [15]
(S)-(+)-CBPG Drug Info [22]
(S)-3HPG Drug Info [15]
3,5-DHPG Drug Info [15]
CHPG Drug Info [15]
ibotenate Drug Info [15]
L-CCG-I Drug Info [15]
Inhibitor (3-(2-methylquinolin-7-yl)phenyl)methanol Drug Info [23]
(3-Ethoxy-pyridin-2-yl)-pyridin-2-yl-amine Drug Info [24]
(E)-1-Adamantan-1-yl-3-quinolin-3-yl-propenone Drug Info [25]
(E)-3-[2-(2-methyl-4-thiazolyl)vinyl]pyridine Drug Info [26]
1-(3-(2-methylquinolin-7-yl)phenyl)ethanone Drug Info [23]
2-(2-Methyl-thiazol-4-ylethynyl)-pyridine Drug Info [27]
2-(2-methylquinolin-7-yl)benzonitrile Drug Info [23]
2-(3,4-dimethylphenyl)-1,8-naphthyridine Drug Info [28]
2-(3,5-dichlorophenyl)pyrido[2,3-d]pyrimidine Drug Info [29]
2-(3,5-difluorophenyl)-7-methyl-1,8-naphthyridine Drug Info [28]
2-(3,5-dimethoxyphenyl)-1,8-naphthyridine Drug Info [28]
2-(3-(2-methylquinolin-7-yl)phenyl)acetonitrile Drug Info [23]
2-(3-(3-methoxyphenoxy)prop-1-ynyl)pyridine Drug Info [30]
2-(3-(benzyloxy)phenyl)isoindoline-1,3-dione Drug Info [31]
2-(3-bromophenyl)-7-methyl-1,8-naphthyridine Drug Info [28]
2-(3-bromophenyl)-7-methylpyrido[2,3-d]pyrimidine Drug Info [29]
2-(3-bromophenyl)pyrido[2,3-d]pyrimidine Drug Info [29]
2-(3-chlorobenzyloxy)-6-chloroisonicotinonitrile Drug Info [31]
2-(3-chlorophenyl)-7-methyl-1,8-naphthyridine Drug Info [28]
2-(4-(3-chlorophenyl)but-1-ynyl)-6-methylpyridine Drug Info [32]
2-(m-tolylethynyl)pyrimidine Drug Info [33]
2-(phenylethynyl)pyrimidine Drug Info [33]
2-(pyridin-2-yl)-4-(m-tolylthio)pyrimidine Drug Info [34]
2-Benzoxy-5-(2-methylquinolin-7-yl)benzonitrile Drug Info [35]
2-benzyloxy-7,8-dihydro-6H-quinolin-5-one Drug Info [36]
2-bromo-4-(3-fluorophenylethynyl)thiazole Drug Info [26]
2-Chloro-5-(2-methylquinolin-7-yl)nicotinonitrile Drug Info [35]
2-chloro-N-(3-(3-chlorobenzamido)phenyl)benzamide Drug Info [37]
2-Cyclohex-1-enylethynyl-pyridine Drug Info [38]
2-Cyclohexylethynyl-pyridine Drug Info [38]
2-Cyclopent-1-enylethynyl-pyridine Drug Info [38]
2-ethoxy-5-(m-tolylethynyl)pyrimidine Drug Info [33]
2-ethynyl-4-(3-fluorophenylethynyl)thiazole Drug Info [26]
2-m-tolyl-1,8-naphthyridine Drug Info [28]
2-methyl-4-(2-thienylethynyl)thiazole Drug Info [26]
2-methyl-4-(3-thienylethynyl)thiazole Drug Info [26]
2-methyl-4-(m-tolylethynyl)thiazole Drug Info [26]
2-methyl-4-(pyridin-3-ylethynyl)thiazole Drug Info [35]
2-Methyl-4-o-tolylethynyl-thiazole Drug Info [27]
2-Methyl-4-p-tolylethynyl-thiazole Drug Info [27]
2-Methyl-4-phenylethynyl-thiazole Drug Info [27]
2-methyl-6-((3-methoxyphenyl)ethynyl)-pyridine Drug Info [39]
2-methyl-6-(3-(p-tolyloxy)prop-1-ynyl)pyridine Drug Info [30]
2-methyl-6-(3-(phenylthio)prop-1-ynyl)pyridine Drug Info [32]
2-methyl-6-(4-phenylbut-1-ynyl)pyridine Drug Info [32]
2-methyl-6-(4-phenylpent-1-ynyl)pyridine Drug Info [32]
2-methyl-6-(5-phenylpent-1-ynyl)pyridine Drug Info [32]
2-methyl-6-(phenylethynyl)pyridine Drug Info [40]
2-methyl-7-(pyridin-3-yl)quinoline Drug Info [23]
2-methyl-7-m-tolyl-1,6-naphthyridine Drug Info [28]
2-methyl-7-m-tolyl-1,8-naphthyridine Drug Info [28]
2-methyl-7-m-tolylquinoline Drug Info [23]
2-methyl-7-phenyl-1,8-naphthyridine Drug Info [28]
2-methyl-7-phenylquinoline Drug Info [23]
2-phenyl-1,8-naphthyridine Drug Info [28]
2-Phenyl-5-(2-methylthiazol-4ylethynyl)pyridine Drug Info [41]
2-phenylethynyl-5,6,7,8-tetrahydro-quinolin-5-ol Drug Info [36]
2-phenylethynyl-5,6,7,8-tetrahydro-quinoline Drug Info [36]
2-phenylethynyl-7,8-dihydro-6H-quinolin-5-one Drug Info [36]
2-[(2-methyl-4-thiazolyl)ethynyl]pyrazine Drug Info [26]
3-(1,5-naphthyridin-3-yl)benzonitrile Drug Info [28]
3-(1,8-naphthyridin-2-yl)benzonitrile Drug Info [28]
3-(1-Pyridin-2-yl-1H-pyrazol-3-yl)-benzonitrile Drug Info [42]
3-(1-Pyridin-2-yl-1H-pyrazol-4-yl)-benzonitrile Drug Info [42]
3-(1-Pyridin-2-yl-1H-pyrrol-3-yl)-benzonitrile Drug Info [42]
3-(2-methylbenzo[d]thiazol-5-yl)benzonitrile Drug Info [43]
3-(2-methylquinolin-7-yl)benzonitrile Drug Info [23]
3-(2-methylquinolin-7-yl)phenol Drug Info [23]
3-(2-Pyridin-2-yl-2H-tetrazol-5-yl)-benzonitrile Drug Info [42]
3-(3,4-dimethylphenyl)-1,5-naphthyridine Drug Info [28]
3-(3-(3-chlorobenzyloxy)-5-methylphenyl)pyridine Drug Info [31]
3-(3-bromophenylethynyl)-5-methyl[1,2,4]triazine Drug Info [44]
3-(3-methylphenylethynyl)-5-methyl[1,2,4]triazine Drug Info [44]
3-(3-Pyridin-2-yl-pyrazol-1-yl)-benzonitrile Drug Info [42]
3-(3-Pyridin-2-yl-pyrrol-1-yl)-benzonitrile Drug Info [42]
3-(4-Pyridin-2-yl-imidazol-1-yl)-benzonitrile Drug Info [42]
3-(4-Pyridin-2-yl-pyrazol-1-yl)-benzonitrile Drug Info [42]
3-(5-Pyridin-2-yl-tetrazol-2-yl)-benzonitrile Drug Info [42]
3-(6-fluoroquinazolin-4-ylamino)benzonitrile Drug Info [40]
3-(7-methyl-1,8-naphthyridin-2-yl)benzonitrile Drug Info [28]
3-biphenyl-4-ylethynyl-5-methyl-[1,2,4]triazine Drug Info [44]
3-bromo-5-(2-methylquinolin-7-yl)benzonitrile Drug Info [23]
3-bromo-5-[(2-methyl-4-thiazolyl)ethynyl]pyridine Drug Info [26]
3-bromo-N-(6-methylpyridin-2-yl)benzamide Drug Info [45]
3-chloro-5-(2-methylquinolin-7-yl)benzonitrile Drug Info [23]
3-chloro-N-(3-isobutyramidophenyl)benzamide Drug Info [37]
3-chloro-N-(4-methylthiazol-2-yl)benzamide Drug Info [45]
3-chloro-N-(6-chloropyridin-2-yl)benzamide Drug Info [45]
3-chloro-N-(6-methylpyridin-2-yl)benzamide Drug Info [41]
3-cyano-5-fluoro-N-(3-fluorophenyl)benzamide Drug Info [46]
3-cyano-5-fluoro-N-(pyridin-2-yl)benzamide Drug Info [46]
3-cyano-5-fluoro-N-m-tolylbenzamide Drug Info [46]
3-cyano-5-fluoro-N-phenylbenzamide Drug Info [46]
3-cyano-N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide Drug Info [47]
3-cyano-N-(1,4-diphenyl-1H-pyrazol-5-yl)benzamide Drug Info [47]
3-cyano-N-(3-cyanophenyl)-5-fluorobenzamide Drug Info [46]
3-cyano-N-(3-ethylphenyl)-5-fluorobenzamide Drug Info [46]
3-cyano-N-(3-ethynylphenyl)-5-fluorobenzamide Drug Info [46]
3-cyano-N-(6-ethylpyridin-2-yl)-5-fluorobenzamide Drug Info [46]
3-cyano-N-(6-methylpyridin-2-yl)benzamide Drug Info [41]
3-ethoxy-5-(2-methylquinolin-7-yl)benzonitrile Drug Info [23]
3-fluoro-5-(1,6-naphthyridin-7-yl)benzonitrile Drug Info [28]
3-fluoro-5-(2-methylquinolin-7-yl)benzonitrile Drug Info [23]
3-hydroxy-5-(2-methylquinolin-7-yl)benzonitrile Drug Info [23]
3-iodo-N-(6-methylpyridin-2-yl)benzamide Drug Info [45]
3-isobutoxy-5-(2-methylquinolin-7-yl)benzonitrile Drug Info [23]
3-m-tolyl-1,5-naphthyridine Drug Info [28]
3-methoxy-5-(1,5-naphthyridin-3-yl)benzonitrile Drug Info [28]
3-methoxy-5-(1,6-naphthyridin-7-yl)benzonitrile Drug Info [28]
3-methoxy-5-(2-methylquinolin-7-yl)benzonitrile Drug Info [23]
3-methoxy-N-(4-methylthiazol-2-yl)benzamide Drug Info [45]
3-methoxy-N-(6-methylpyridin-2-yl)benzamide Drug Info [45]
3-methyl-5-(2-methylquinolin-7-yl)benzonitrile Drug Info [23]
3-methyl-N-(6-methylpyridin-2-yl)benzamide Drug Info [45]
3-nitro-N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide Drug Info [47]
3-Phenyl-1-(2-methylthiazol-4-ylethynyl)benzene Drug Info [41]
3-[(2,5-dimethyl-4-thiazolyl)ethynyl]pyridine Drug Info [26]
3-[(2-methyl-4-thiazolyl)ethynyl]-5-vinylpyridine Drug Info [26]
3-[(2-methyl-4-thiazolyl)ethynyl]benzamide Drug Info [26]
3-[(2-methyl-4-thiazolyl)ethynyl]benzonitrile Drug Info [26]
3-[(2-methyl-4-thiazolyl)ethynyl]phenol Drug Info [26]
3-[(5-ethyl-2-methyl-4-thiazolyl)ethynyl]pyridine Drug Info [26]
3-[(6-Methylpyridin-2-yl)ethynyl]benzonitrile Drug Info [41]
4-(2-(3-fluorophenyl)ethynyl)-2-methylthiazole Drug Info [26]
4-(2-(4-fluorophenyl)ethynyl)-2-methylthiazole Drug Info [26]
4-(2-fluorophenylethynyl)-2-methylthiazole Drug Info [26]
4-(2-methoxyphenylethynyl)-2-methylthiazole Drug Info [26]
4-(2-Methyl-thiazol-4-ylethynyl)-pyridine Drug Info [27]
4-(3,5-difluorophenylethynyl)-2-methylthiazole Drug Info [26]
4-(3-bromophenoxy)-6-chloroquinazoline Drug Info [40]
4-(3-bromophenylthio)-2-(pyridin-2-yl)pyrimidine Drug Info [34]
4-(3-chlorophenylethynyl)-2-methylthiazole Drug Info [26]
4-(3-chlorophenylthio)-2-(pyridin-2-yl)pyrimidine Drug Info [34]
4-(3-fluorophenylethynyl)-2-thiazolylamine Drug Info [26]
4-(3-methoxyphenylethynyl)-2-methylthiazole Drug Info [26]
4-(3-pyridylethynyl)-2-thiazolylamine Drug Info [26]
4-(4-chlorophenylthio)-2-(pyridin-2-yl)pyrimidine Drug Info [34]
4-Biphenyl-2-ylethynyl-2-methyl-thiazole Drug Info [27]
4-Biphenyl-4-ylethynyl-2-methyl-thiazole Drug Info [27]
4-cyano-N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide Drug Info [47]
4-nitro-N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide Drug Info [47]
5-((6-Methylpyridin-2-yl)ethynyl)nicotinonitrile Drug Info [35]
5-(2-(2,5-dimethylphenyl)ethynyl)pyrimidine Drug Info [48]
5-(2-(3,5-difluorophenyl)ethynyl)pyrimidine Drug Info [48]
5-(2-(3-chlorophenyl)ethynyl)pyrimidine Drug Info [48]
5-(2-(4-fluoro-3-methylphenyl)ethynyl)pyrimidine Drug Info [48]
5-(2-m-tolylethynyl)pyrimidine Drug Info [48]
5-(2-Methylquinolin-7-yl)-2-phenylbenzonitrile Drug Info [35]
5-(2-Methylquinolin-7-yl)-2-phenylnicotinonitrile Drug Info [35]
5-(2-methylquinolin-7-yl)isophthalonitrile Drug Info [23]
5-(2-methylquinolin-7-yl)nicotinonitrile Drug Info [23]
5-(3-chlorophenylethynyl)-5-methyl[1,2,4]triazine Drug Info [44]
5-(phenylethynyl)pyrimidine Drug Info [48]
5-Biphenyl-4-ylethynyl-pyrimidine Drug Info [48]
5-Chloro-2-(2-methylquinolin-7-yl)benzonitrile Drug Info [35]
5-methyl-3-phenylethynyl[1,2,4]triazine Drug Info [44]
5-[(2-methyl-4-thiazolyl)ethynyl]pyrimidine Drug Info [26]
6-(4-chlorophenylamino)-N,N-diethylnicotinamide Drug Info [49]
6-bromo-N-(3-bromophenyl)quinazolin-4-amine Drug Info [40]
6-bromo-N-(3-chlorophenyl)quinazolin-4-amine Drug Info [40]
6-bromo-N-(3-fluorophenyl)quinazolin-4-amine Drug Info [40]
6-bromo-N-m-tolylquinazolin-4-amine Drug Info [40]
6-chloro-N-(3-chlorophenyl)quinazolin-4-amine Drug Info [40]
6-fluoro-N-m-tolylquinazolin-4-amine Drug Info [40]
6-phenylethynyl-nicotinic acid methyl ester Drug Info [36]
7-(2-methoxyphenyl)-2-methylquinoline Drug Info [23]
7-(3,5-dimethoxyphenyl)-1,6-naphthyridine Drug Info [28]
7-(3-(methoxymethyl)phenyl)-2-methylquinoline Drug Info [23]
7-(3-chlorophenyl)-2-methylquinoline Drug Info [23]
7-(3-fluoro-5-methylphenyl)-1,6-naphthyridine Drug Info [28]
7-(3-fluorophenyl)-2-methylquinoline Drug Info [23]
7-(3-methoxyphenyl)-2-methyl-1,6-naphthyridine Drug Info [28]
7-(3-methoxyphenyl)-2-methylquinoline Drug Info [23]
7-(4,6-dimethoxypyrimidin-2-yl)-2-methylquinoline Drug Info [43]
7-(4,6-dimethylpyrimidin-2-yl)-2-methylquinoline Drug Info [43]
7-(4-methoxyphenyl)-2-methylquinoline Drug Info [23]
7-(4-methoxypyrimidin-2-yl)-2-methylquinoline Drug Info [43]
7-bromo-N-(3-bromophenyl)isoquinolin-1-amine Drug Info [40]
7-m-tolyl-1,6-naphthyridine Drug Info [28]
7-methyl-2-m-tolylpyrido[2,3-d]pyrimidine Drug Info [29]
7-methyl-2-phenylpyrido[2,3-d]pyrimidine Drug Info [29]
GLUTAMATE Drug Info [50]
N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide Drug Info [47]
N-(1,4-diphenyl-1H-pyrazol-5-yl)benzamide Drug Info [47]
N-(2-phenylimidazo[1,2-a]pyridin-3-yl)benzamide Drug Info [47]
N-(3-(3-cyanobenzamido)phenyl)-2-methoxybenzamide Drug Info [37]
N-(3-acetamidophenyl)-3-chlorobenzamide Drug Info [37]
N-(3-bromophenyl)-6-chloroquinazolin-4-amine Drug Info [40]
N-(3-bromophenyl)-6-fluoroquinazolin-4-amine Drug Info [40]
N-(3-chlorophenyl)-3-cyano-5-fluorobenzamide Drug Info [46]
N-(3-chlorophenyl)-6-fluoroquinazolin-4-amine Drug Info [40]
N-(3-chlorophenyl)-6-methoxyquinazolin-4-amine Drug Info [40]
N-(3-chlorophenyl)-6-nitroquinazolin-4-amine Drug Info [40]
N-(6-methylpyridin-2-yl)-5-phenylpicolinamide Drug Info [51]
N-(6-methylpyridin-2-yl)-6-phenylnicotinamide Drug Info [41]
N-(6-methylpyridin-2-yl)biphenyl-3-carboxamide Drug Info [41]
N-cyclopentyl-6-(2-phenylethynyl)nicotinamide Drug Info [52]
N-[4-(3-pyridylethynyl)-2-thiazolyl]acetamide Drug Info [26]
QUISQUALATE Drug Info [53]
SIB-1757 Drug Info [45]
SIB-1893 Drug Info [45]
Modulator (allosteric modulator) 3,3'-difluorobenzaldazine Drug Info [54]
5-MPEP Drug Info [55]
5PAM523 Drug Info [56]
alloswitch-1 Drug Info [57]
BOMA Drug Info [58]
Br-5MPEPy Drug Info [55]
CDPPB Drug Info [59]
compound 10 Drug Info [60]
compound 10 Drug Info [61]
compound 11a Drug Info [58]
compound 13 Drug Info [16]
compound 16a Drug Info [58]
compound 16m Drug Info [49]
compound 18 Drug Info [29]
compound 18 Drug Info [62]
compound 20 Drug Info [31]
compound 23 Drug Info [23]
compound 24 Drug Info [63]
compound 24d Drug Info [64]
compound 26 Drug Info [31]
compound 27 Drug Info [46]
compound 29b Drug Info [65]
compound 30 Drug Info [66]
compound 36 Drug Info [28]
compound 41 Drug Info [67]
compound 42 Drug Info [68]
compound 47 Drug Info [69]
compound 53 Drug Info [67]
compound 8 Drug Info [60]
compound 8 Drug Info [46]
CPPHA Drug Info [70]
CPPZ Drug Info [71]
LSN2463359 Drug Info [72]
LSN2814617 Drug Info [72]
M-5MPEP Drug Info [55]
methoxymethyl-MTEP Drug Info [73]
MPEP Drug Info [74]
MTEB Drug Info [58]
NCFP Drug Info [75]
PTeB Drug Info [42]
SP203 Drug Info [76]
VU-1545 Drug Info [47]
VU-29 Drug Info [77]
VU0092273 Drug Info [78]
VU0240382 Drug Info [78]
VU0285683 Drug Info [79]
VU0357121 Drug Info [80]
VU0360172 Drug Info [79]
VU0361747 Drug Info [78]
VU0364289 Drug Info [81]
VU0366058 Drug Info [82]
VU0404251 Drug Info [83]
VU0424465 Drug Info [84]
VU0463841 Drug Info [85]
[14C]MTEP Drug Info [73]
[3H]CTEP Drug Info [86]
[3H]fenobam Drug Info [87]
[3H]M-MPEP Drug Info [88]
[3H]methoxy-PEPy Drug Info [89]
[3H]methoxymethyl-MTEP Drug Info [89]
Modulator ADX-48621 Drug Info [90]
ADX-63365 Drug Info [18]
ADX10059 Drug Info [91], [92]
AFQ056 Drug Info [93]
GRN-529 Drug Info [18]
LY-3390334 Drug Info
McN3377 Drug Info [19]
MK-3328 Drug Info [18]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Huntington&#039
s disease
PANTHER Pathway Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway
Metabotropic glutamate receptor group III pathway
Metabotropic glutamate receptor group I pathway
Endogenous cannabinoid signaling
Reactome G alpha (q) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)
WikiPathways Hypothetical Network for Drug Addiction
GPCRs, Class C Metabotropic glutamate, pheromone
Gastrin-CREB signalling pathway via PKC and MAPK
GPCR ligand binding
GPCR downstream signaling
References
REF 1ClinicalTrials.gov (NCT01433354) Long-term, Safety and Tolerability Study of AFQ056 in Adolescent Patients With Fragile X Syndrome (Open-label). U.S. National Institutes of Health.
REF 2(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7586).
REF 3ClinicalTrials.gov (NCT01336088) ADX48621 for the Treatment of Levodopa Induced Dyskinesia in Patients With Parkinson's Disease. U.S. National Institutes of Health.
REF 4(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6452).
REF 5ClinicalTrials.gov (NCT00820105) ADX10059 Migraine Prevention Study. U.S. National Institutes of Health.
REF 6ClinicalTrials.gov (NCT01750957) A Study of RO4917523 in Pediatric Patients With Fragile X Syndrome. U.S. National Institutes of Health.
REF 7ClinicalTrials.gov (NCT01325740) A Study to Assess the Tolerability of a Single Dose of STX107 in Adults With Fragile X Syndrome. U.S. National Institutes of Health.
REF 8(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3336).
REF 9ClinicalTrials.gov (NCT00637221) Open Label Study Investigating Safety and Efficacy of NPL2009 50 mg - 150 mg on Prepulse Inhibition Tests and Continuous Performance Tasks, Adults With Fragile X Syndrome. U.S. National Institutes of Health.
REF 10(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1434).
REF 11ClinicalTrials.gov (NCT00954538) Safety, Radiation Dosimetry, Biokinetics, and Effectiveness of [18F]MK3328 (MK-3328-001). U.S. National Institutes of Health.
REF 12Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027605)
REF 13Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029648)
REF 14Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015556)
REF 15Characterization of [(3)H]Quisqualate binding to recombinant rat metabotropic glutamate 1a and 5a receptors and to rat and human brain sections. J Neurochem. 2000 Dec;75(6):2590-601.
REF 16Dipyridyl amides: potent metabotropic glutamate subtype 5 (mGlu5) receptor antagonists. Bioorg Med Chem Lett. 2005 Feb 15;15(4):1197-200.
REF 17Clinical pipeline report, company report or official report of AstraZeneca (2009).
REF 18(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 293).
REF 19Glutamate- and GABA-based CNS therapeutics. Curr Opin Pharmacol. 2006 Feb;6(1):7-17.
REF 20The challenges of clinical trials in fragile X syndrome. Psychopharmacology (Berl) 2014; 231(6): 1237-1250.
REF 21Social Communication is an Emerging Target for Pharmacotherapy in Autism Spectrum Disorder - A Review of the Literature on Potential Agents. J Can Acad Child Adolesc Psychiatry. 2014 February; 23(1):20-30.
REF 22Biochemical and electrophysiological studies on (S)-(+)-2-(3'-carboxybicyclo(1.1.1)pentyl)-glycine (CBPG), a novel mGlu5 receptor agonist endowed with mGlu1 receptor antagonist activity. Neuropharmacology. 1999 Jul;38(7):917-26.
REF 23Bioorg Med Chem Lett. 2007 Aug 15;17(16):4415-8. Epub 2007 Jun 10.Rational design of 7-arylquinolines as non-competitive metabotropic glutamate receptor subtype 5 antagonists.
REF 24Bioorg Med Chem Lett. 2005 Oct 1;15(19):4350-3.Dipyridyl amines: potent metabotropic glutamate subtype 5 receptor antagonists.
REF 25Bioorg Med Chem. 2009 Aug 1;17(15):5708-15. Epub 2009 Jun 23.Synergism of virtual screening and medicinal chemistry: identification and optimization of allosteric antagonists of metabotropic glutamate receptor 1.
REF 26J Med Chem. 2006 Feb 9;49(3):1080-100.Synthesis and structure-activity relationships of 3-[(2-methyl-1,3-thiazol-4-yl)ethynyl]pyridine analogues as potent, noncompetitive metabotropic glutamate receptor subtype 5 antagonists; search for cocaine medications.
REF 27Bioorg Med Chem Lett. 2004 Aug 2;14(15):3993-6.5-[(2-Methyl-1,3-thiazol-4-yl)ethynyl]-2,3'-bipyridine: a highly potent, orally active metabotropic glutamate subtype 5 (mGlu5) receptor antagonist withanxiolytic activity.
REF 28Bioorg Med Chem Lett. 2007 Dec 1;17(23):6525-8. Epub 2007 Sep 29.Synthesis and SAR comparison of regioisomeric aryl naphthyridines as potent mGlu5 receptor antagonists.
REF 29Bioorg Med Chem Lett. 2007 Oct 1;17(19):5396-9. Epub 2007 Aug 6.Synthesis and SAR of 2-aryl pyrido[2,3-d]pyrimidines as potent mGlu5 receptor antagonists.
REF 30Bioorg Med Chem Lett. 2006 Sep 15;16(18):4792-5. Epub 2006 Jul 12.A new series of pyridinyl-alkynes as antagonists of the metabotropic glutamate receptor 5 (mGluR5).
REF 31Bioorg Med Chem Lett. 2006 Apr 1;16(7):1892-7. Epub 2006 Jan 24.Arylmethoxypyridines as novel, potent and orally active mGlu5 receptor antagonists.
REF 32Bioorg Med Chem Lett. 2006 Sep 15;16(18):4788-91. Epub 2006 Jul 11.Structure-activity relationships for the linker in a series of pyridinyl-alkynes that are antagonists of the metabotropic glutamatereceptor 5 (mGluR5).
REF 33J Med Chem. 2009 Jul 23;52(14):4103-6.Discovery of molecular switches that modulate modes of metabotropic glutamate receptor subtype 5 (mGlu5) pharmacology in vitro and in vivo within a series of functionalized, regioisomeric 2- and 5-(phenylethynyl)pyrimidines.
REF 34Bioorg Med Chem Lett. 2006 May 1;16(9):2467-9. Epub 2006 Feb 14.Structure-activity relationship of thiopyrimidines as mGluR5 antagonists.
REF 35Bioorg Med Chem. 2010 May 1;18(9):3026-35. Epub 2010 Mar 27.Structure-activity relationships in a novel series of 7-substituted-aryl quinolines and 5-substituted-aryl benzothiazoles at the metabotropic glutamate receptor subtype 5.
REF 36J Med Chem. 2008 Feb 14;51(3):634-47. Epub 2008 Jan 4.Positive and negative modulation of group I metabotropic glutamate receptors.
REF 37Bioorg Med Chem Lett. 2009 Dec 1;19(23):6502-6. Epub 2009 Oct 28.Synthesis and SAR of novel, non-MPEP chemotype mGluR5 NAMs identified by functional HTS.
REF 38Bioorg Med Chem Lett. 2005 Oct 15;15(20):4589-93.Cyclohexenyl- and dehydropiperidinyl-alkynyl pyridines as potent metabotropic glutamate subtype 5 (mGlu5) receptor antagonists.
REF 39Bioorg Med Chem. 2007 Jan 15;15(2):903-14. Epub 2006 Oct 21.ABP688, a novel selective and high affinity ligand for the labeling of mGlu5 receptors: identification, in vitro pharmacology, pharmacokinetic and biodistribution studies.
REF 40Bioorg Med Chem Lett. 2009 Dec 1;19(23):6623-6. Epub 2009 Oct 9.Discovery and SAR of 6-substituted-4-anilinoquinazolines as non-competitive antagonists of mGlu5.
REF 41J Med Chem. 2009 Jun 11;52(11):3563-75.Structure-activity relationships comparing N-(6-methylpyridin-yl)-substituted aryl amides to 2-methyl-6-(substituted-arylethynyl)pyridines or 2-methyl-4-(substituted-arylethynyl)thiazoles as novel metabotropic glutamate receptor subtype 5 antagonists.
REF 42J Med Chem. 2004 Sep 9;47(19):4645-8.Discovery of novel heteroarylazoles that are metabotropic glutamate subtype 5 receptor antagonists with anxiolytic activity.
REF 43Bioorg Med Chem Lett. 2007 Jun 1;17(11):2987-91. Epub 2007 Mar 24.Discovery of heterobicyclic templates for novel metabotropic glutamate receptor subtype 5 antagonists.
REF 44J Med Chem. 2007 Jul 12;50(14):3388-91. Epub 2007 Jun 15.Synthesis and pharmacological evaluation of phenylethynyl[1,2,4]methyltriazines as analogues of 3-methyl-6-(phenylethynyl)pyridine.
REF 45Bioorg Med Chem Lett. 2006 Jul 1;16(13):3371-5. Epub 2006 May 5.Design and synthesis of noncompetitive metabotropic glutamate receptor subtype 5 antagonists.
REF 46Bioorg Med Chem Lett. 2010 Aug 1;20(15):4390-4. Epub 2010 Jun 15.3-Cyano-5-fluoro-N-arylbenzamides as negative allosteric modulators of mGlu(5): Identification of easily prepared tool compounds withCNS exposure in rats.
REF 47J Med Chem. 2006 Jun 1;49(11):3332-44.Substituent effects of N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamides on positive allosteric modulation of the metabotropic glutamate-5 receptor in rat cortical astrocytes.
REF 48Bioorg Med Chem Lett. 2008 Jul 15;18(14):4098-101. Epub 2008 May 29.Synthesis and SAR of a mGluR5 allosteric partial antagonist lead: unexpected modulation of pharmacology with slight structural modifications to a 5-(phenylethynyl)pyrimidine scaffold.
REF 49Bioorg Med Chem Lett. 2010 Jan 1;20(1):184-8. Epub 2009 Nov 5.Piperidyl amides as novel, potent and orally active mGlu5 receptor antagonists with anxiolytic-like activity.
REF 50J Med Chem. 2007 Sep 20;50(19):4630-41. Epub 2007 Aug 29.Synthesis, molecular modeling studies, and preliminary pharmacological characterization of all possible 2-(2'-sulfonocyclopropyl)glycine stereoisomers as conformationally constrained L-homocysteic acid analogs.
REF 51Bioorg Med Chem Lett. 2007 Apr 1;17(7):2074-9. Epub 2007 Jan 4.Design and synthesis of novel heterobiaryl amides as metabotropic glutamate receptor subtype 5 antagonists.
REF 52Bioorg Med Chem Lett. 2009 Jun 15;19(12):3275-8. Epub 2009 Apr 24.Discovery of a potent and brain penetrant mGluR5 positive allosteric modulator.
REF 53J Med Chem. 1998 Mar 12;41(6):930-9.Excitatory amino acid receptor ligands: resolution, absolute stereochemistry, and enantiopharmacology of 2-amino-3-(4-butyl-3-hydroxyisoxazol-5-yl)propionic acid.
REF 54A family of highly selective allosteric modulators of the metabotropic glutamate receptor subtype 5. Mol Pharmacol. 2003 Sep;64(3):731-40.
REF 55A close structural analog of 2-methyl-6-(phenylethynyl)-pyridine acts as a neutral allosteric site ligand on metabotropic glutamate receptor subtype 5 and blocks the effects of multiple allosteric modulators. Mol Pharmacol. 2005 Dec;68(6):1793-802. Epub 2005 Sep 9.
REF 56Mechanism based neurotoxicity of mGlu5 positive allosteric modulators--development challenges for a promising novel antipsychotic target. Neuropharmacology. 2014 Jul;82:161-73.
REF 57An allosteric modulator to control endogenous G protein-coupled receptors with light. Nat Chem Biol. 2014 Oct;10(10):813-5.
REF 58Discovery of novel modulators of metabotropic glutamate receptor subtype-5. Bioorg Med Chem. 2004 Jan 2;12(1):17-21.
REF 59Discovery of positive allosteric modulators for the metabotropic glutamate receptor subtype 5 from a series of N-(1,3-diphenyl-1H- pyrazol-5-yl)benzamides that potentiate receptor function in vivo. JMed Chem. 2004 Nov 18;47(24):5825-8.
REF 60Discovery of highly potent, selective, orally bioavailable, metabotropic glutamate subtype 5 (mGlu5) receptor antagonists devoid of cytochrome P450 1A2 inhibitory activity. Bioorg Med Chem Lett. 2004Nov 15;14(22):5481-4.
REF 612-(2-[3-(pyridin-3-yloxy)phenyl]-2H-tetrazol-5-yl) pyridine: a highly potent, orally active, metabotropic glutamate subtype 5 (mGlu5) receptor antagonist. Bioorg Med Chem Lett. 2004 Nov 15;14(22):5473-6.
REF 62(3-Cyano-5-fluorophenyl)biaryl negative allosteric modulators of mGlu(5): Discovery of a new tool compound with activity in the OSS mouse model of addiction. ACS Chem Neurosci. 2011 Aug 17;2(8):471-482.
REF 63Discovery of (1R,2R)-N-(4-(6-isopropylpyridin-2-yl)-3-(2-methyl-2H-indazol-5-yl)isothiazol-5-yl)-2-methylcyclopropanecarboxamide, a potent and orally efficacious mGlu5 receptor negative allosteric modulator. Bioorg Med Chem Lett. 2013 Mar 1;23(5):1249-52.
REF 64Discovery and structure-activity relationship of 1,3-cyclohexyl amide derivatives as novel mGluR5 negative allosteric modulators. Bioorg Med Chem Lett. 2013 Mar 1;23(5):1398-406.
REF 65Design, synthesis, and structure-activity relationships of novel bicyclic azole-amines as negative allosteric modulators of metabotropic glutamate receptor 5. J Med Chem. 2010 Oct 14;53(19):7107-18.
REF 666-Aryl-3-pyrrolidinylpyridines as mGlu5 receptor negative allosteric modulators. Bioorg Med Chem Lett. 2011 Aug 15;21(16):4891-9.
REF 67Discovery of biological evaluation of pyrazole/imidazole amides as mGlu5 receptor negative allosteric modulators. Bioorg Med Chem Lett. 2013 Apr 1;23(7):2134-9.
REF 68Rational design, synthesis, and structure-activity relationship of benzoxazolones: new potent mglu5 receptor antagonists based on the fenobam structure. Bioorg Med Chem Lett. 2007 Mar 1;17(5):1302-6.Epub 2006 Dec 15.
REF 69Discovery of novel positive allosteric modulators of the metabotropic glutamate receptor 5 (mGlu5). Bioorg Med Chem Lett. 2011 Mar 1;21(5):1402-6.
REF 70A novel selective allosteric modulator potentiates the activity of native metabotropic glutamate receptor subtype 5 in rat forebrain. J Pharmacol Exp Ther. 2004 May;309(2):568-77. Epub 2004 Jan 27.
REF 71Preclinical profile of a novel metabotropic glutamate receptor 5 positive allosteric modulator. Eur J Pharmacol. 2011 Jun 1;659(2-3):146-54.
REF 72In vitro characterisation of the novel positive allosteric modulators of the mGlu??receptor, LSN2463359 and LSN2814617, and their effects on sleep architecture and operant responding in the rat. Neuropharmacology. 2013 Jan;64:224-39.
REF 73[3H]Methoxymethyl-3-[(2-methyl-1,3-thiazol-4-yl)ethynyl]pyridine binding to metabotropic glutamate receptor subtype 5 in rodent brain: in vitro and in vivo characterization. J Pharmacol Exp Ther. 2002 Dec;303(3):1044-51.
REF 742-Methyl-6-(phenylethynyl)-pyridine (MPEP), a potent, selective and systemically active mGlu5 receptor antagonist. Neuropharmacology. 1999 Oct;38(10):1493-503.
REF 75A novel metabotropic glutamate receptor 5 positive allosteric modulator acts at a unique site and confers stimulus bias to mGlu5 signaling. Mol Pharmacol. 2013 Apr;83(4):835-47.
REF 76Synthesis and simple 18F-labeling of 3-fluoro-5-(2-(2-(fluoromethyl)thiazol-4-yl)ethynyl)benzonitrile as a high affinity radioligand for imaging monkey brain metabotropic glutamate subtype-5 receptors with positron emission tomography. J Med Chem. 2007 Jul 12;50(14):3256-66. Epub 2007 Jun 16.
REF 77Interaction of novel positive allosteric modulators of metabotropic glutamate receptor 5 with the negative allosteric antagonist site is required for potentiation of receptor responses. Mol Pharmacol. 2007 May;71(5):1389-98. Epub 2007 Feb 15.
REF 78Functional impact of allosteric agonist activity of selective positive allosteric modulators of metabotropic glutamate receptor subtype 5 in regulating central nervous system function. Mol Pharmacol.2012 Feb;81(2):120-33.
REF 79Discovery of novel allosteric modulators of metabotropic glutamate receptor subtype 5 reveals chemical and functional diversity and in vivo activity in rat behavioral models of anxiolytic and antipsychotic activity. Mol Pharmacol. 2010 Dec;78(6):1105-23.
REF 80Discovery of a Novel Chemical Class of mGlu(5) Allosteric Ligands with Distinct Modes of Pharmacology. ACS Chem Neurosci. 2010 Oct 20;1(10):702-716. Epub 2010 Aug 19.
REF 81Discovery of N-Aryl Piperazines as Selective mGlu(5) Potentiators with Efficacy in a Rodent Model Predictive of Anti-Psychotic Activity. ACS Med Chem Lett. 2010 Nov 11;1(8):433-438. Epub 2010 Aug 13.
REF 82Discovery of 2-(2-benzoxazoyl amino)-4-aryl-5-cyanopyrimidine as negative allosteric modulators (NAMs) of metabotropic glutamate receptor?? (mGlu??: from an artificial neural network virtual screen to an in vivo tool compound. ChemMedChem. 2012 Mar 5;7(3):406-14.
REF 83Optimization of an ether series of mGlu5 positive allosteric modulators: molecular determinants of MPEP-site interaction crossover. Bioorg Med Chem Lett. 2012 Oct 15;22(20):6481-5.
REF 84Unique signaling profiles of positive allosteric modulators of metabotropic glutamate receptor subtype 5 determine differences in in vivo activity. Biol Psychiatry. 2013 Mar 15;73(6):501-9.
REF 85Substituted 1-Phenyl-3-(pyridin-2-yl)urea negative allosteric modulators of mGlu5: discovery of a new tool compound VU0463841 with activity in rat models of cocaine addiction. ACS Chem Neurosci. 2013Aug 21;4(8):1217-28.
REF 86CTEP: a novel, potent, long-acting, and orally bioavailable metabotropic glutamate receptor 5 inhibitor. J Pharmacol Exp Ther. 2011 Nov;339(2):474-86.
REF 87Fenobam: a clinically validated nonbenzodiazepine anxiolytic is a potent, selective, and noncompetitive mGlu5 receptor antagonist with inverse agonist activity. J Pharmacol Exp Ther. 2005 Nov;315(2):711-21. Epub 2005 Jul 22.
REF 88[(3)H]-M-MPEP, a potent, subtype-selective radioligand for the metabotropic glutamate receptor subtype 5. Bioorg Med Chem Lett. 2002 Feb 11;12(3):407-9.
REF 89[3H]-methoxymethyl-MTEP and [3H]-methoxy-PEPy: potent and selective radioligands for the metabotropic glutamate subtype 5 (mGlu5) receptor. Bioorg Med Chem Lett. 2003 Feb 10;13(3):351-4.
REF 90Pipeline of Addex Pharma. Addex Pharma. 2009.
REF 91Novel treatments of GERD: focus on the lower esophageal sphincter. Eur Rev Med Pharmacol Sci. 2008 Aug;12 Suppl 1:103-10.
REF 92A Proof Of Concept Study Evaluating The Effect Of ADX10059, A Metabotropic Glutamate Receptor-5 Negative Allosteric Modulator, On Acid Exposure And Symptoms In Gastro-Esophageal Reflux Disease. Gut. 2009 May 20.
REF 93Metabolism and disposition of the metabotropic glutamate receptor 5 antagonist (mGluR5) mavoglurant (AFQ056) in healthy subjects. Drug Metab Dispos. 2013 Sep;41(9):1626-41.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.