Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T58992
|
||||
Former ID |
TTDS00128
|
||||
Target Name |
Delta-type opioid receptor
|
||||
Gene Name |
OPRD1
|
||||
Synonyms |
DOR-1; Delta opioid receptor; OPRD1
|
||||
Target Type |
Successful
|
||||
Disease | Acute nonspecific diarrhea; Chronic diarrhea associated with inflammatory bowel disease [ICD10: K50, K60] | ||||
Alcohol use disorders [ICD9: 303; ICD10: F10.2] | |||||
Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42] | |||||
Acute migraine [ICD9: 346; ICD10: G43] | |||||
Bladder disease [ICD10: N30-N32] | |||||
Cough [ICD9: 786.2; ICD10: R05] | |||||
Diarrhea-predominant IBS [ICD9: 564.1; ICD10: K58.0] | |||||
Ischemic heart diseases [ICD9: 410-414; ICD10: I20-I25] | |||||
Moderate-to-severe pain [ICD10: R52, G89] | |||||
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
Overactive bladder disorder [ICD9: 188, 596.51; ICD10: C67, N32.81] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Premature ejaculation [ICD9: 302.75; ICD10: F52.4] | |||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Substance dependence [ICD10: F10-F19] | |||||
Urinary incontinence [ICD9: 788.3; ICD10: N39.3, N39.4, R32] | |||||
Function |
G-protein coupled receptor that functions as receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T58992
|
||||
UniProt ID | |||||
Sequence |
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC TPSDGPGGGAAA |
||||
Drugs and Mode of Action | |||||
Drug(s) | Butorphanol | Drug Info | Approved | Pain | [1], [2] |
Codeine | Drug Info | Approved | Pain | [3], [4] | |
Eluxadoline | Drug Info | Approved | Diarrhea-predominant IBS | [5], [6] | |
Hydromorphone | Drug Info | Approved | Moderate-to-severe pain | [7] | |
Loperamide | Drug Info | Approved | Acute nonspecific diarrhea; Chronic diarrhea associated with inflammatory bowel disease | [7] | |
Oxycodone | Drug Info | Approved | Pain | [8], [9] | |
ADL-5747 | Drug Info | Phase 2 | Pain | [10] | |
ADL-5859 | Drug Info | Phase 2 | Rheumatoid arthritis | [11] | |
AZD-2327 | Drug Info | Phase 2 | Anxiety disorder | [12] | |
Carfentanil | Drug Info | Phase 2 | Discovery agent | [13] | |
Met-enkephalin | Drug Info | Phase 2 | Pain | [14], [15] | |
TPM-1/Morphine | Drug Info | Phase 2 | Pain | [16] | |
Codeine | Drug Info | Phase 1 | Cough | [17], [4] | |
MCP-201 | Drug Info | Phase 1 | Pain | [18] | |
MCP-202 | Drug Info | Phase 1 | Overactive bladder disorder | [19] | |
BIO-306 | Drug Info | Preclinical | Acute migraine | [20] | |
SoRI-9409 | Drug Info | Preclinical | Alcohol use disorders | [21] | |
DPI-3290 | Drug Info | Discontinued in Phase 2 | Pain | [22] | |
DYNORPHIN A | Drug Info | Discontinued in Phase 2 | Discovery agent | [23], [24] | |
TRK-851 | Drug Info | Discontinued in Phase 1 | Cough | [25] | |
VP004 | Drug Info | Discontinued in Phase 1 | Substance dependence | [26] | |
BIPHALIN | Drug Info | Terminated | Discovery agent | [27] | |
BW 373U86 | Drug Info | Terminated | Discovery agent | [28] | |
LY-255582 | Drug Info | Terminated | Discovery agent | [29] | |
SB-213698 | Drug Info | Terminated | Discovery agent | [30] | |
SB-219825 | Drug Info | Terminated | Pain | [31] | |
SNF-9007 | Drug Info | Terminated | Discovery agent | [32] | |
Inhibitor | (-)-cyclorphan | Drug Info | [33] | ||
(-)-eseroline | Drug Info | [34] | |||
(-)-isoelaeocarpiline | Drug Info | [35] | |||
(H-Dmt-Tic-Glu-NH-(CH(2))(5)-CO-Dap(6DMN)-NH(2) | Drug Info | [36] | |||
1,10-bis-(Dmt-Tic-amino)decane | Drug Info | [37] | |||
1,4-bis-(Dmt-Tic-amino)butane | Drug Info | [37] | |||
1,6-bis-(Dmt-Tic-amino)hexane | Drug Info | [37] | |||
1,6-bis-(N,N-dimethyl-Dmt-Tic-NH)hexane | Drug Info | [37] | |||
1-(1,2-diphenylethyl)-4-phenylpiperidin-4-ol | Drug Info | [38] | |||
1-(2-ethoxy-1-phenylethyl)-4-phenylpiperidin-4-ol | Drug Info | [38] | |||
1-(dio-tolylmethyl)-4-phenylpiperidin-4-ol | Drug Info | [38] | |||
1-benzhydryl-4-(2-fluorophenyl)piperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-(2-methoxyphenyl)piperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-(3-fluorophenyl)piperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-(3-methoxyphenyl)piperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-(3-phenylpropyl)piperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-(4-bromophenyl)piperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-(4-chlorophenyl)piperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-(4-fluorophenyl)piperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-(4-methoxyphenyl)piperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-(benzyloxy)-4-phenylpiperidine | Drug Info | [38] | |||
1-benzhydryl-4-(furan-2-yl)piperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-(thiophen-2-yl)piperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-benzylpiperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-butylpiperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-cyclohexylpiperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-ethoxy-4-phenylpiperidine | Drug Info | [38] | |||
1-benzhydryl-4-hexylpiperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-m-tolylpiperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-methoxy-4-phenylpiperidine | Drug Info | [38] | |||
1-benzhydryl-4-o-tolylpiperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-p-tolylpiperidin-4-ol | Drug Info | [39] | |||
1-benzhydryl-4-phenyl-4-propoxypiperidine | Drug Info | [38] | |||
1-benzhydryl-4-phenylpiperidin-4-ol | Drug Info | [40] | |||
1-[3-(3-biphenyl)-(1,2,4-triazol-4-yl) ]-3-phenol | Drug Info | [41] | |||
1-[3-(4-biphenyl)-(1,2,4-triazol-4-yl) ]-3-phenol | Drug Info | [41] | |||
14-O-phenylpropylnaltrexone | Drug Info | [42] | |||
17-(Cyclobutylmethyl)-N-phenylmorphinan-3-amine | Drug Info | [43] | |||
17-(Cyclopropylmethyl)-N-phenylmorphinan-3-amine | Drug Info | [43] | |||
17-methyl-4'-methyldihydromorphinone | Drug Info | [44] | |||
17-Methylmorphinan-3-yl 4-Iodophenyl Carbamate | Drug Info | [43] | |||
2-Hydroxymethyl-3-hydroxymorphinan | Drug Info | [43] | |||
3,6-bis(Dmt-Tic-NH-butyl)-2(1H)-pyrazinone | Drug Info | [37] | |||
3,6-bis(Dmt-Tic-NH-ethyl)-2(1H)-pyrazinone | Drug Info | [37] | |||
3,6-bis(Dmt-Tic-NH-methyl)-2(1H)-pyrazinone | Drug Info | [37] | |||
3,6-bis(Dmt-Tic-NH-propyl)-2(1H)-pyrazinone | Drug Info | [37] | |||
3-desoxy-3-carboxamidonaltrexone | Drug Info | [45] | |||
4-(4-((phenethylamino)methyl)phenoxy)benzamide | Drug Info | [46] | |||
4-(p-Tolyl)spiro[chromene-2,4'-piperidine] | Drug Info | [47] | |||
4-(Spiro[chromene-2,4'-piperidine]-4-yl)benzamide | Drug Info | [48] | |||
4-(Spiro[chromene-2,4'-piperidine]-4-yl)phenol | Drug Info | [47] | |||
4-phenyl-1-(1-phenylbutyl)piperidin-4-ol | Drug Info | [38] | |||
4-phenyl-1-(1-phenylheptyl)piperidin-4-ol | Drug Info | [38] | |||
4-phenyl-1-(1-phenylhexyl)piperidin-4-ol | Drug Info | [38] | |||
4-phenyl-1-(1-phenylpentyl)piperidin-4-ol | Drug Info | [38] | |||
4-phenyl-1-(phenyl(m-tolyl)methyl)piperidin-4-ol | Drug Info | [38] | |||
4-phenyl-1-(phenyl(o-tolyl)methyl)piperidin-4-ol | Drug Info | [38] | |||
4-phenyl-1-(phenyl(p-tolyl)methyl)piperidin-4-ol | Drug Info | [38] | |||
4-phenyl-4-[1H-imidazol-2-yl]-piperidine | Drug Info | [49] | |||
4-Phenylspiro[chromene-2,4'-piperidine] | Drug Info | [47] | |||
5-(4-((phenethylamino)methyl)phenoxy)picolinamide | Drug Info | [46] | |||
6-(2-phenethylisoindolin-5-yloxy)nicotinamide | Drug Info | [50] | |||
6-(4-((benzylamino)methyl)phenoxy)nicotinamide | Drug Info | [46] | |||
6-(4-((phenethylamino)methyl)phenoxy)nicotinamide | Drug Info | [50] | |||
6-(4-(2-(benzylamino)ethyl)phenoxy)nicotinamide | Drug Info | [50] | |||
6-(4-(3-(benzylamino)propyl)phenoxy)nicotinamide | Drug Info | [46] | |||
6-(Allyl-methyl-amino)-4,4-diphenyl-heptan-3-ol | Drug Info | [51] | |||
6-cinnamoyl-N-methylstephasunoline | Drug Info | [52] | |||
6-cinnamoylhernandine | Drug Info | [52] | |||
6-desoxonaltrexone | Drug Info | [45] | |||
6beta-naltrexol HCl | Drug Info | [53] | |||
8-azabicyclo[3.2.1]octan-3-yloxy-benzamide | Drug Info | [54] | |||
8-carboxamidocyclazocine | Drug Info | [55] | |||
AKNADILACTAM | Drug Info | [52] | |||
AMINOFENTANYL | Drug Info | [56] | |||
ANALOG OF DYNORPHIN A | Drug Info | [57] | |||
Antanal 1 | Drug Info | [58] | |||
Antanal 2 | Drug Info | [58] | |||
Benzyl derivative of M6G | Drug Info | [59] | |||
BIPHALIN | Drug Info | [60] | |||
Bis-((-)-N-propargylmorphinan-3-yl) sebacoylate | Drug Info | [33] | |||
BUTORPHAN | Drug Info | [61] | |||
CARBOXYFENTANYL | Drug Info | [62] | |||
CCDC 710249, HCl salt | Drug Info | [45] | |||
Cis-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH | Drug Info | [63] | |||
Clocinnamox | Drug Info | [42] | |||
CYCLAZOCINE | Drug Info | [64] | |||
CYCLORPHAN | Drug Info | [43] | |||
C[L-mTyr-D-pro-L-Phe-D-trp] | Drug Info | [65] | |||
C[L-Phe-D-pro-L-mTyr-D-trp] | Drug Info | [65] | |||
C[L-Phe-D-pro-L-Phe-L-trp] | Drug Info | [65] | |||
D-Phe-Cys-Tyr-D-Trp-Arg-Thr-Pen-Thr-NH2(CTAP) | Drug Info | [66] | |||
D-Phe-Cys-Tyr-D-Trp-Lys-Thr-Pen-Thr-NH2(CTP) | Drug Info | [66] | |||
D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2(CTOP) | Drug Info | [66] | |||
D-PhGly-Cys-Tyr-D-Trp-Lys-Thr-Pen-Thr-NH2 | Drug Info | [66] | |||
DAMGO | Drug Info | [67] | |||
Dcp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 | Drug Info | [68] | |||
Delta-kappa opioid heterodimer | Drug Info | [69] | |||
DELTORPHIN | Drug Info | [70] | |||
DELTORPHIN-II | Drug Info | [71] | |||
Deprotected cogener of M6G | Drug Info | [59] | |||
DERMORPHIN | Drug Info | [72] | |||
Dhp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 | Drug Info | [68] | |||
Dimepheptanol | Drug Info | [51] | |||
Dmt-Pro-3,5Dmp-Phe-NH2 | Drug Info | [73] | |||
Dmt-Pro-Dmp-Phe-NH2 | Drug Info | [73] | |||
Dmt-Pro-Dmt-Phe-NH2 | Drug Info | [73] | |||
Dmt-Pro-Emp-Phe-NH2 | Drug Info | [73] | |||
Dmt-Pro-Imp-Phe-NH2 | Drug Info | [73] | |||
Dmt-Pro-Mmp-Phe-NH2 | Drug Info | [73] | |||
Dmt-Pro-Phe-D-1-Nal-NH2 | Drug Info | [74] | |||
Dmt-Pro-Phe-D-2-Nal-NH2 | Drug Info | [74] | |||
Dmt-Pro-Phe-Phe-NH2 | Drug Info | [73] | |||
Dmt-Pro-Tmp-Phe-NH2 | Drug Info | [73] | |||
Dmt-Pro-Trp-D-2-Nal-NH2 | Drug Info | [74] | |||
DPDPE | Drug Info | [67] | |||
DYNORPHIN A | Drug Info | [57] | |||
ELAEOCARPENINE | Drug Info | [75] | |||
ENDOMORPHIN 2 | Drug Info | [76] | |||
ENDOMORPHIN-1 | Drug Info | [77] | |||
ETONITAZENE | Drug Info | [78] | |||
FALCARINDIOL | Drug Info | [79] | |||
Grandisine C | Drug Info | [35] | |||
Grandisine D | Drug Info | [35] | |||
Grandisine F | Drug Info | [35] | |||
GUANIDINONALTRINDOLE | Drug Info | [80] | |||
H-2',6'-dimethyltyrosine-Tic-OH | Drug Info | [81] | |||
H-2',6'-dimethyltyrosine-Tic-Phe-Phe-OH | Drug Info | [81] | |||
H-Aba-ala-Gly-Phe-leu-OH | Drug Info | [82] | |||
H-Aba-ala-Gly-Phe-Met-OH | Drug Info | [82] | |||
H-Aba-Gly-Gly-Phe-Leu-OH | Drug Info | [82] | |||
H-Aba-ser-Gly-Phe-Leu-Thr-OH | Drug Info | [82] | |||
H-Apa-ala-Gly-Phe-leu-OH | Drug Info | [82] | |||
H-Cdp-ala-Gly-Phe-leu-OH | Drug Info | [82] | |||
H-Cdp-Gly-Gly-Phe-Leu-OH | Drug Info | [82] | |||
H-Cdp-ser-Gly-Phe-Leu-Thr-OH | Drug Info | [82] | |||
H-Cpa-c[pen-Gly-Phe-pen]OH | Drug Info | [82] | |||
H-Cpa-Gly-Gly-Phe-Met-NH2 | Drug Info | [82] | |||
H-Cpa-Gly-Gly-Phe-Met-OH | Drug Info | [82] | |||
H-Cxp-ala-Gly-Phe-leu-OH | Drug Info | [82] | |||
H-D-Phe-c[Cys-Tyr-DTrp-Orn-Thr-Pen]-Thr-NH2 | Drug Info | [58] | |||
H-D-Tca-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 | Drug Info | [83] | |||
H-D-Tic-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 | Drug Info | [83] | |||
H-D-Trp-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 | Drug Info | [83] | |||
H-Dmt-Aba-Gly-NH-CH2-Bid | Drug Info | [84] | |||
H-Dmt-Aba-Gly-NH-CH2-Ph | Drug Info | [84] | |||
H-Dmt-Aba-Gly-NH-Ph | Drug Info | [84] | |||
H-Dmt-D-Arg(NO2)-Phe-Lys(Z)-NH2 | Drug Info | [85] | |||
H-Dmt-D-Arg(NO2)-Phe-Lys(Z)-OH | Drug Info | [85] | |||
H-Dmt-Tic-(2R,3R)-beta-MeCha-Phe-NH2 | Drug Info | [86] | |||
H-Dmt-Tic-(2R,3R)-beta-MeCha-Phe-OH | Drug Info | [86] | |||
H-Dmt-Tic-(2R,3S)-beta-MeCha-Phe-NH2 | Drug Info | [86] | |||
H-Dmt-Tic-(2R,3S)-beta-MeCha-Phe-OH | Drug Info | [86] | |||
H-Dmt-Tic-(2S,3R)-beta-MeCha-Phe-NH2 | Drug Info | [86] | |||
H-Dmt-Tic-(2S,3R)-beta-MeCha-Phe-OH | Drug Info | [86] | |||
H-Dmt-Tic-(2S,3S)-beta-MeCha-Phe-NH2 | Drug Info | [86] | |||
H-Dmt-Tic-(2S,3S)-beta-MeCha-Phe-OH | Drug Info | [86] | |||
H-Dmt-Tic-Asp-N(Me)-Ph | Drug Info | [87] | |||
H-Dmt-Tic-Asp-NH-Bzl | Drug Info | [87] | |||
H-Dmt-Tic-Asp-NH-Ph | Drug Info | [87] | |||
H-Dmt-Tic-D-Asp-N(Me)-Ph | Drug Info | [87] | |||
H-Dmt-Tic-D-Asp-NH-Ph | Drug Info | [87] | |||
H-Dmt-Tic-Glu-Dap(6DMN)-NH(2) | Drug Info | [36] | |||
H-Dmt-Tic-Glu-NH-(CH2)5-NH2 | Drug Info | [88] | |||
H-Dmt-Tic-Glu-NH2 | Drug Info | [88] | |||
H-Dmt-Tic-Gly-N(Me)-Ph | Drug Info | [87] | |||
H-Dmt-Tic-Gly-NH-Bzl | Drug Info | [87] | |||
H-Dmt-Tic-Gly-NH-CH2-Bid | Drug Info | [84] | |||
H-Dmt-Tic-Gly-NH-Ph | Drug Info | [87] | |||
H-Dmt-Tic-Lys(Ac)-NH-CH2-Ph | Drug Info | [89] | |||
H-Dmt-Tic-Lys(Ac)-NH-Ph | Drug Info | [89] | |||
H-Dmt-Tic-Lys(Z)-NH-CH2-Ph | Drug Info | [89] | |||
H-Dmt-Tic-Lys(Z)-NH-Ph | Drug Info | [89] | |||
H-Dmt-Tic-Lys-NH-CH2-Ph | Drug Info | [89] | |||
H-Dmt-Tic-Lys-NH-Ph | Drug Info | [89] | |||
H-Dmt-Tic-NH-(CH2)6-NH-Dmt-H | Drug Info | [90] | |||
H-Dmt-Tic-NH-(CH2)6-NH-Phe-H | Drug Info | [90] | |||
H-Dmt-Tic-NH-(CH2)6-NH-Tic-H | Drug Info | [90] | |||
H-Dmt-Tic-NH-(D)-CH[(CH2)4-NH-Z]-Bid | Drug Info | [89] | |||
H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid | Drug Info | [87] | |||
H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid(N1-Me) | Drug Info | [87] | |||
H-Dmt-Tic-NH-(S)CH(CH2-COOH)-Bid(N1-Me) | Drug Info | [87] | |||
H-Dmt-Tic-NH-CH2-Boa | Drug Info | [91] | |||
H-Dmt-Tic-NH-CH2-Bta | Drug Info | [91] | |||
H-Dmt-Tic-NH-CH2-CH2-NH2 | Drug Info | [92] | |||
H-Dmt-Tic-NH-CH2-Imid | Drug Info | [91] | |||
H-Dmt-Tic-NH-CH2-ImidPh | Drug Info | [91] | |||
H-Dmt-Tic-NH-CH2-Indl | Drug Info | [91] | |||
H-Dmt-Tic-NH-CH2-Indn | Drug Info | [91] | |||
H-Dmt-Tic-NH-CH[(CH2)4-NH-Ac]-Bid | Drug Info | [89] | |||
H-Dmt-Tic-NH-CH[(CH2)4-NH-Z]-Bid | Drug Info | [89] | |||
H-Dmt-Tic-NH-CH[(CH2)4-NH2]-Bid | Drug Info | [89] | |||
H-Dmt-Tic-OH | Drug Info | [37] | |||
H-mCpa-ala-Gly-Phe-leu-OH | Drug Info | [82] | |||
H-mCpa-Gly-Gly-Phe-Leu-OH | Drug Info | [82] | |||
H-mCpa-ser-Gly-Phe-Leu-Thr-OH | Drug Info | [82] | |||
H-Poa-ser-Gly-Phe-Leu-Thr-OH | Drug Info | [82] | |||
H-Tyr-c[cys-Gly-Phe(p-NO2)-cys]NH2 | Drug Info | [82] | |||
H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]-OH | Drug Info | [63] | |||
H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]NH2 | Drug Info | [93] | |||
H-Tyr-c[D-Allylgly-Gly-Phe-L-Allylgly]NH2 | Drug Info | [93] | |||
H-Tyr-c[D-Cys-Gly-Phe-D-Cys]NH2 | Drug Info | [93] | |||
H-Tyr-c[D-Cys-Gly-Phe-L-Cys]NH2 | Drug Info | [93] | |||
H-Tyr-c[D-Orn-(D or L)Atc-Glu]-NH2 | Drug Info | [94] | |||
H-Tyr-c[D-Orn-Aic-Glu]-NH2 | Drug Info | [94] | |||
H-Tyr-c[pen-Gly-Phe-pen]OH | Drug Info | [82] | |||
H-Tyr-D-Ala-Gly Phe-Pro-Leu-Trp-O-3,5-Bzl(CF3)2 | Drug Info | [95] | |||
H-Tyr-D-Ala-Gly-Phe-D-Leu | Drug Info | [96] | |||
H-Tyr-D-Ala-Gly-Phe-NH-NH-(NMe)Phe-Asp-Nle-Trp-Ac | Drug Info | [97] | |||
H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Phe-D-Asp-D-Nle-Trp-H | Drug Info | [98] | |||
H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Trp-Nle-Asp-Phe-Bo | Drug Info | [98] | |||
H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Trp-Nle-Asp-Phe-H | Drug Info | [98] | |||
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-D-Trp-Boc | Drug Info | [97] | |||
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-D-Trp-H | Drug Info | [97] | |||
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-Trp-Ac | Drug Info | [97] | |||
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-Trp-Boc | Drug Info | [97] | |||
H-Tyr-D-Ala-Gly-Phe-NH-NH-Trp-D-Nle-D-Asp-D-Phe-H | Drug Info | [98] | |||
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NH-3,5-Bzl(CF3)2 | Drug Info | [95] | |||
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NH-Bzl | Drug Info | [95] | |||
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NMe-3,5-Bzl(CF3)2 | Drug Info | [95] | |||
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NMe-Bzl | Drug Info | [95] | |||
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-O-Bzl | Drug Info | [95] | |||
H-Tyr-Gly-Gly-Phe-Met-NH2 | Drug Info | [82] | |||
H-Tyr-Gly-Gly-Phe-Met-OH | Drug Info | [82] | |||
H-Tyr-NMe-D-Ala-Phe-Sar-NH2 | Drug Info | [99] | |||
H-Tyr-Pro-Dap(6DMN)-Phe-NH2 | Drug Info | [36] | |||
H-Tyr-Pro-Phe-Phe-NH-(CH2)5-(C=O)-Dap(6DMN)-NH2 | Drug Info | [36] | |||
H-Tyr-Pro-Phe-Phe-NH-CH2-CH2-NH Tic Dmt-H | Drug Info | [92] | |||
H-Tyr-Tic-Cha-Phe-OH | Drug Info | [86] | |||
H-Tyr-Tic-OH | Drug Info | [81] | |||
H-Tyr-Tic-Phe-Phe-OH | Drug Info | [86] | |||
HERKINORIN | Drug Info | [100] | |||
HTyr-Gly-Gly-Phe-Leu-Arg-Arg-lle-Arg-Pro-LysNH2 | Drug Info | [101] | |||
ICI-174864 | Drug Info | [102] | |||
ICI-199441 | Drug Info | [103] | |||
ISOELAEOCARPINE | Drug Info | [104] | |||
LOFENTANIL | Drug Info | [105] | |||
LONGANINE | Drug Info | [52] | |||
LOPHOCLADINE A | Drug Info | [106] | |||
LY-255582 | Drug Info | [107] | |||
M6G thiosaccharide analogue | Drug Info | [59] | |||
MC-CAM | Drug Info | [108] | |||
MCL-117 | Drug Info | [33] | |||
MCL-139 | Drug Info | [33] | |||
MCL-144 | Drug Info | [109] | |||
MCL-145 | Drug Info | [33] | |||
MCL-147 | Drug Info | [110] | |||
MCL-149 | Drug Info | [110] | |||
MCL-153 | Drug Info | [61] | |||
MCL-154 | Drug Info | [61] | |||
MCL-182 | Drug Info | [110] | |||
MCL-183 | Drug Info | [110] | |||
MCL-428 | Drug Info | [111] | |||
MCL-429 | Drug Info | [111] | |||
MCL-431 | Drug Info | [111] | |||
MCL-432 | Drug Info | [111] | |||
MCL-433 | Drug Info | [111] | |||
MCL-434 | Drug Info | [111] | |||
MCL-435 | Drug Info | [111] | |||
MCL-443 | Drug Info | [111] | |||
MCL-444 | Drug Info | [111] | |||
MCL-445 | Drug Info | [110] | |||
MCL-446 | Drug Info | [110] | |||
MCL-447 | Drug Info | [110] | |||
MCL-448 | Drug Info | [110] | |||
MCL-449 | Drug Info | [111] | |||
MCL-450 | Drug Info | [112] | |||
MCL-451 | Drug Info | [112] | |||
MCL-458 | Drug Info | [110] | |||
METAZOCINE | Drug Info | [113] | |||
N-(17-Methylmorphinan-3-yl)-N'-phenylurea | Drug Info | [43] | |||
N-(4-Iodophenyl)-N'-(17-methylmorphinan-3-yl)urea | Drug Info | [43] | |||
N-alpha-amidino-Tyr(Me)-Pro-Trp-p-Cl-Phe-NH2 | Drug Info | [114] | |||
N-alpha-amidino-Tyr(Me)-Pro-Trp-Phe-NH2 | Drug Info | [114] | |||
N-Benzyl-17-(cyclobutylmethyl)morphinan-3-amine | Drug Info | [43] | |||
N-Benzyl-17-(cyclopropylmethyl)morphinan-3-amine | Drug Info | [43] | |||
N-methylstephisoferulin | Drug Info | [52] | |||
N-methylstephuline | Drug Info | [52] | |||
Naltrexone-6-alpha-ol | Drug Info | [113] | |||
Naltrexone-6-beta-ol | Drug Info | [113] | |||
NORBINALTORPHIMINE | Drug Info | [80] | |||
O-DESMETHYL TRAMADOL | Drug Info | [113] | |||
OXYMORPHINDOLE | Drug Info | [115] | |||
PERIPENTADENINE | Drug Info | [116] | |||
PHENAZOCINE | Drug Info | [113] | |||
PROSTEPHABYSSINE | Drug Info | [52] | |||
RTI-5989-23 | Drug Info | [107] | |||
RTI-5989-25 | Drug Info | [107] | |||
RTI-5989-31 | Drug Info | [117] | |||
SALVINORIN A | Drug Info | [100] | |||
SB-0304 | Drug Info | [99] | |||
SB-213698 | Drug Info | [118] | |||
SN-11 | Drug Info | [118] | |||
SN-23 | Drug Info | [118] | |||
SN-28 | Drug Info | [119] | |||
SNF-9007 | Drug Info | [120] | |||
SOMATOSTATIN | Drug Info | [66] | |||
TPM-1/Morphine | Drug Info | [121] | |||
Trans-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH | Drug Info | [63] | |||
Tyr-(NMe)Ala-L-Phe-D-Pro-NH2 | Drug Info | [122] | |||
Tyr-(R)-Aba-Gly-Phe-NH2 | Drug Info | [123] | |||
Tyr-(S)-Aba-Gly-Phe-NH2 | Drug Info | [123] | |||
Tyr-(S)-spiro-Aba-Gly-Phe-NH2 | Drug Info | [123] | |||
Tyr-D-Ala-Gly-D-Trp-Nle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-D-Ala-Gly-D-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-D-Ala-Gly-Phe-Met-NH2 | Drug Info | [60] | |||
Tyr-D-Ala-Gly-Phe-Met-Pro-Leu-Trp-NH-Bzl | Drug Info | [124] | |||
Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-NMeNle-D-Trp-Boc | Drug Info | [97] | |||
Tyr-D-Ala-Gly-Trp-Nle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-D-Ala-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-D-Ala-Phe-Asp-Val-Val-Thr[Beta-D-Glc]-Gly-NH2 | Drug Info | [125] | |||
Tyr-D-Ala-Phe-Glu-Val-Val-Gly-NH2 | Drug Info | [126] | |||
Tyr-D-Ala-Phe-Gly-Tyr-Pro-Thr(Beta-D-Glc)-Gly-NH2 | Drug Info | [125] | |||
Tyr-D-Ala-Phe-Thr(-D-Glc)-Tyr-Pro-Ser-NH2 | Drug Info | [125] | |||
Tyr-D-Met-Phe-His-Leu-Met-Asp-NH2 | Drug Info | [126] | |||
Tyr-D-Nle-Gly-D-Trp-Nle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-D-Nle-Gly-D-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-D-Nle-Gly-Trp-Nle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-D-Nle-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-D-Phe-Gly-D-Trp-Nle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-D-Phe-Gly-D-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-D-Phe-Gly-Trp-Nle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-D-Phe-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-D-Pro-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-Gly-Gly-Phe-c(Cys-Arg-Arg-Ile-Cys)-Arg-lys | Drug Info | [57] | |||
Tyr-Gly-Gly-Phe-leu-c(Cys-Arg-Ile-Arg-Cys)-lys | Drug Info | [57] | |||
Tyr-Gly-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-Pro-3,5Dmp-Phe-NH2 | Drug Info | [73] | |||
Tyr-Pro-D-Phe-D-Pro-NH2 | Drug Info | [122] | |||
Tyr-Pro-D-Phe-Pro-NH2 | Drug Info | [122] | |||
Tyr-Pro-D-Phg-Phe-NH2 | Drug Info | [127] | |||
Tyr-Pro-Dmp-Phe-NH2 | Drug Info | [73] | |||
Tyr-Pro-Dmt-Phe-NH2 | Drug Info | [73] | |||
Tyr-Pro-Emp-Phe-NH2 | Drug Info | [73] | |||
Tyr-Pro-Gly-Trp-NMeNle-Asp-Phe-NH2 | Drug Info | [120] | |||
Tyr-Pro-Imp-Phe-NH2 | Drug Info | [73] | |||
Tyr-Pro-L-(NMe)Phe-D-Pro-NH2 | Drug Info | [122] | |||
Tyr-Pro-L-(NMe)Phe-Pro-NH2 | Drug Info | [122] | |||
Tyr-Pro-L-Phe-D-Pro-NH2 | Drug Info | [122] | |||
Tyr-Pro-L-Phe-Pro-NH2 | Drug Info | [122] | |||
Tyr-Pro-Mmp-Phe-NH | Drug Info | [73] | |||
Tyr-Pro-Phe-Phe-N(CH3)2 | Drug Info | [128] | |||
Tyr-Pro-Phe-Phe-NHCH3 | Drug Info | [128] | |||
Tyr-Pro-Phe-Phe-NHNH2 | Drug Info | [128] | |||
Tyr-Pro-Phe-Phe-OC(CH3)3 | Drug Info | [128] | |||
Tyr-Pro-Phe-Phe-OCH2CH3 | Drug Info | [128] | |||
Tyr-Pro-Phe-Phe-OCH2OH | Drug Info | [128] | |||
Tyr-Pro-Phe-Phe-OCH3 | Drug Info | [128] | |||
Tyr-Pro-Tmp-Phe-NH | Drug Info | [73] | |||
UFP-502 | Drug Info | [71] | |||
UFP-512 | Drug Info | [71] | |||
[Dcp1]Dyn A(1-11)-NH2 | Drug Info | [68] | |||
[Leu5]enkephalin | Drug Info | [129] | |||
Agonist | 3-Methylfentanyl | Drug Info | [130] | ||
3-Methylthiofentanyl | Drug Info | [131] | |||
ADL-5747 | Drug Info | [132] | |||
ADL-5859 | Drug Info | [132] | |||
ARD-412 | Drug Info | [132] | |||
AZD-2327 | Drug Info | [133] | |||
BBI-11008 | Drug Info | [132] | |||
Beta-endorphin | Drug Info | [134] | |||
BIO-306 | Drug Info | [20] | |||
Butorphanol | Drug Info | [135] | |||
BW 373U86 | Drug Info | [136] | |||
Carfentanil | Drug Info | [137] | |||
Codeine | Drug Info | [135] | |||
DADLE | Drug Info | [138] | |||
Dihydromorphine | Drug Info | [139] | |||
Dimethylthiambutene | Drug Info | [140] | |||
DPI-221 | Drug Info | [132] | |||
DPI-3290 | Drug Info | [141] | |||
DSLET | Drug Info | [132] | |||
DSTBULET | Drug Info | [142] | |||
dynorphin B | Drug Info | [132] | |||
ethyketazocine | Drug Info | [143] | |||
ethylketocyclazocine | Drug Info | [132] | |||
Etorphine | Drug Info | [144] | |||
Leu-enkephalin | Drug Info | [145] | |||
MCP-201 | Drug Info | [146] | |||
MCP-202 | Drug Info | [147] | |||
MCP-203 | Drug Info | [132] | |||
MCP-204 | Drug Info | [132] | |||
MCP-205 | Drug Info | [132] | |||
Met-enkephalin | Drug Info | [148] | |||
normorphine | Drug Info | [132] | |||
NRP290 | Drug Info | [132] | |||
Oxycodone | Drug Info | [149] | |||
SB 227122 | Drug Info | [150] | |||
SNC-80 | Drug Info | [151], [152] | |||
Tonazocine mesylate | Drug Info | [151] | |||
[3H]diprenorphine | Drug Info | [132] | |||
Antagonist | 7-benzylidenenaltrexone | Drug Info | [153] | ||
CTAP | Drug Info | [132] | |||
Diprenorphine | Drug Info | [154] | |||
ICI 154129 | Drug Info | [155] | |||
naltriben | Drug Info | [156] | |||
Naltrindole | Drug Info | [153] | |||
quadazocine | Drug Info | [132] | |||
SoRI-9409 | Drug Info | [157] | |||
TIP | Drug Info | [158] | |||
TIPP | Drug Info | [158] | |||
TIPPpsi | Drug Info | [159] | |||
TRK-851 | Drug Info | [160], [7] | |||
[3H]naltriben | Drug Info | [161] | |||
[3H]naltrindole | Drug Info | [162] | |||
Modulator | Eluxadoline | Drug Info | |||
SB-219825 | Drug Info | [163] | |||
Binder | Hydromorphone | Drug Info | [164] | ||
Loperamide | Drug Info | [165] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | cGMP-PKG signaling pathway | ||||
Sphingolipid signaling pathway | |||||
Neuroactive ligand-receptor interaction | |||||
PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
Enkephalin release | |||||
Opioid proenkephalin pathway | |||||
Opioid proopiomelanocortin pathway | |||||
Reactome | Peptide ligand-binding receptors | ||||
G alpha (i) signalling events | |||||
WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
Peptide GPCRs | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
REF 1 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075046. | ||||
REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7591). | ||||
REF 3 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074256. | ||||
REF 4 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1673). | ||||
REF 5 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7691). | ||||
REF 6 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031329) | ||||
REF 7 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 8 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 085910. | ||||
REF 9 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7093). | ||||
REF 10 | ClinicalTrials.gov (NCT01058642) Study to Assess the Efficacy, Safety, and Tolerability of ADL5747 in Patients With Postherpetic Neuralgia. U.S. National Institutes of Health. | ||||
REF 11 | ClinicalTrials.gov (NCT00626275) Study Evaluating the Analgesic Efficacy and Safety of ADL5859 in Subjects With Rheumatoid Arthritis. U.S. National Institutes of Health. | ||||
REF 12 | ClinicalTrials.gov (NCT00759395) Study of Antidepressant Efficacy of a Selective, High Affinity Enkephalinergic Agonist in Anxious Major Depressive Disorder (AMDD). U.S. National Institutes of Health. | ||||
REF 13 | ClinicalTrials.gov (NCT01899170) Towards Individualized Deep Brain Stimulation Treatment of Chronic Neuropathic Pain. U.S. National Institutes of Health. | ||||
REF 14 | ClinicalTrials.gov (NCT00109941) Opioid Growth Factor in Treating Patients With Advanced Pancreatic Cancer That Cannot Be Removed By Surgery. U.S. National Institutes of Health. | ||||
REF 15 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1614). | ||||
REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023017) | ||||
REF 17 | Effects of a mu-opioid receptor agonist (codeine phosphate) on visuo-motor coordination and dynamic visual acuity in man. Br J Clin Pharmacol. 1986 Nov;22(5):507-12. | ||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018011) | ||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018026) | ||||
REF 20 | Pharmacologic therapeutics for cardiac reperfusion injury. Expert Opin Emerg Drugs. 2007 Sep;12(3):367-88. | ||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028893) | ||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010668) | ||||
REF 23 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1620). | ||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005877) | ||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015232) | ||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025668) | ||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008840) | ||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001926) | ||||
REF 29 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005187) | ||||
REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006271) | ||||
REF 31 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008418) | ||||
REF 32 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006885) | ||||
REF 33 | J Med Chem. 2006 Jan 12;49(1):256-62.Synthesis and preliminary in vitro investigation of bivalent ligands containing homo- and heterodimeric pharmacophores at mu, delta, and kappa opioid receptors. | ||||
REF 34 | Akuammine and dihydroakuammine, two indolomonoterpene alkaloids displaying affinity for opioid receptors. J Nat Prod. 1992 Mar;55(3):380-4. | ||||
REF 35 | J Nat Prod. 2006 Sep;69(9):1295-9.Grandisines C-G, indolizidine alkaloids from the Australian rainforest tree Elaeocarpus grandis. | ||||
REF 36 | J Med Chem. 2006 Jun 15;49(12):3653-8.6-N,N-dimethylamino-2,3-naphthalimide: a new environment-sensitive fluorescent probe in delta- and mu-selective opioid peptides. | ||||
REF 37 | J Med Chem. 2005 Dec 15;48(25):8035-44.Potent Dmt-Tic pharmacophoric delta- and mu-opioid receptor antagonists. | ||||
REF 38 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3023-7. Epub 2007 Mar 23.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 1. | ||||
REF 39 | Bioorg Med Chem Lett. 2007 Jun 1;17(11):3028-33. Epub 2007 Mar 21.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 2. | ||||
REF 40 | Bioorg Med Chem Lett. 2009 May 1;19(9):2519-23. Epub 2009 Mar 14.The discovery of tropane derivatives as nociceptin receptor ligands for the management of cough and anxiety. | ||||
REF 41 | J Med Chem. 2006 Jul 13;49(14):4044-7.Discovery of novel triazole-based opioid receptor antagonists. | ||||
REF 42 | J Med Chem. 2009 Mar 26;52(6):1553-7.14 beta-O-cinnamoylnaltrexone and related dihydrocodeinones are mu opioid receptor partial agonists with predominant antagonist activity. | ||||
REF 43 | J Med Chem. 2010 Jan 14;53(1):402-18.Synthesis and opioid receptor binding affinities of 2-substituted and 3-aminomorphinans: ligands for mu, kappa, and delta opioid receptors. | ||||
REF 44 | J Med Chem. 2006 Aug 24;49(17):5333-8.Structural determinants of opioid activity in derivatives of 14-aminomorphinones: effect of substitution in the aromatic ring of cinnamoylaminomorphinones and codeinones. | ||||
REF 45 | Bioorg Med Chem Lett. 2009 Apr 15;19(8):2289-94. Epub 2009 Feb 25.Syntheses of novel high affinity ligands for opioid receptors. | ||||
REF 46 | Bioorg Med Chem Lett. 2007 Oct 1;17(19):5349-52. Epub 2007 Aug 11.Structure-activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 1. | ||||
REF 47 | J Med Chem. 2008 Oct 9;51(19):5893-6. Epub 2008 Sep 13.Potent, orally bioavailable delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-4-(5-hydroxyspiro[chromene-2,4'-piperidine]-4-yl)benzamide (ADL5859). | ||||
REF 48 | J Med Chem. 2009 Sep 24;52(18):5685-702.Spirocyclic delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-3-hydroxy-4-(spiro[chromene-2,4'-piperidine]-4-yl) benzamide (ADL5747). | ||||
REF 49 | Bioorg Med Chem Lett. 2006 Jan 1;16(1):146-9. Epub 2005 Oct 19.4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives, a novel class of selective delta-opioid agonists. | ||||
REF 50 | Bioorg Med Chem Lett. 2007 Dec 15;17(24):6841-6. Epub 2007 Oct 17.Structure activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 2. | ||||
REF 51 | J Med Chem. 1981 Jul;24(7):903-6.Synthesis of analogues of acetylmethadol and methadol as potential narcotic antagonists. | ||||
REF 52 | J Nat Prod. 2010 May 28;73(5):988-91.Hasubanan alkaloids with delta-opioid binding affinity from the aerial parts of Stephania japonica. | ||||
REF 53 | Bioorg Med Chem Lett. 2009 May 15;19(10):2811-4. Epub 2009 Mar 26.Design, synthesis, and characterization of 6beta-naltrexol analogs, and their selectivity for in vitro opioid receptor subtypes. | ||||
REF 54 | Bioorg Med Chem Lett. 2010 Sep 15;20(18):5405-10. Epub 2010 Aug 3.SAR development of a series of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as kappa opioid receptor antagonists. Part 2. | ||||
REF 55 | Bioorg Med Chem. 2008 May 15;16(10):5653-64. Epub 2008 Mar 30.Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 6: Opioid receptor binding properties of cyclic variants of 8-carboxamidocyclazocine. | ||||
REF 56 | Bioorg Med Chem Lett. 2006 Sep 15;16(18):4946-50. Epub 2006 Jul 7.Synthesis and evaluation of 3-aminopropionyl substituted fentanyl analogues for opioid activity. | ||||
REF 57 | J Med Chem. 1993 Mar 19;36(6):750-7.Design and synthesis of highly potent and selective cyclic dynorphin A analogs. 2. New analogs. | ||||
REF 58 | J Med Chem. 2008 Sep 25;51(18):5866-70.Novel opioid peptide derived antagonists containing (2S)-2-methyl-3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid [(2S)-Mdcp]. | ||||
REF 59 | Bioorg Med Chem Lett. 2005 Mar 15;15(6):1583-6.Synthesis and in vitro biological evaluation of a carbon glycoside analogue of morphine-6-glucuronide. | ||||
REF 60 | Bioorg Med Chem. 2009 Oct 15;17(20):7337-43. Epub 2009 Aug 21.The biological activity and metabolic stability of peptidic bifunctional compounds that are opioid receptor agonists and neurokinin-1 receptor antagonists with a cystine moiety. | ||||
REF 61 | Bioorg Med Chem Lett. 2010 Mar 1;20(5):1507-9. Epub 2010 Jan 25.Effect of linker substitution on the binding of butorphan univalent and bivalent ligands to opioid receptors. | ||||
REF 62 | J Med Chem. 2007 Nov 1;50(22):5528-32. Epub 2007 Oct 10.Development of novel enkephalin analogues that have enhanced opioid activities at both mu and delta opioid receptors. | ||||
REF 63 | J Med Chem. 2007 Jun 28;50(13):3138-42. Epub 2007 Jun 1.Synthesis of stable and potent delta/mu opioid peptides: analogues of H-Tyr-c[D-Cys-Gly-Phe-D-Cys]-OH by ring-closing metathesis. | ||||
REF 64 | Bioorg Med Chem Lett. 2009 Jan 15;19(2):365-8. Epub 2008 Nov 24.Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 7: syntheses and opioid receptor properties of cyclic variants of cyclazocine. | ||||
REF 65 | Bioorg Med Chem Lett. 2009 Jul 1;19(13):3647-50. Epub 2009 May 3.Nascent structure-activity relationship study of a diastereomeric series of kappa opioid receptor antagonists derived from CJ-15,208. | ||||
REF 66 | J Med Chem. 1986 Nov;29(11):2370-5.Design and synthesis of conformationally constrained somatostatin analogues with high potency and specificity for mu opioid receptors. | ||||
REF 67 | Evaluation of N-substitution in 6,7-benzomorphan compounds. Bioorg Med Chem. 2010 Jul 15;18(14):4975-82. doi: 10.1016/j.bmc.2010.06.005. Epub 2010 Jun 9. | ||||
REF 68 | J Med Chem. 2006 Aug 24;49(17):5382-5.Replacement of the N-terminal tyrosine residue in opioid peptides with 3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid (Dcp) results in novel opioid antagonists. | ||||
REF 69 | J Med Chem. 2004 Jun 3;47(12):2969-72.A bivalent ligand (KDN-21) reveals spinal delta and kappa opioid receptors are organized as heterodimers that give rise to delta(1) and kappa(2) phenotypes. Selective targeting of delta-kappa heterodimers. | ||||
REF 70 | J Med Chem. 1994 Jan 7;37(1):146-50.Cyclic enkephalin analogs with exceptional potency at peripheral delta opioid receptors. | ||||
REF 71 | Bioorg Med Chem. 2010 Aug 15;18(16):6024-30. Epub 2010 Jun 25.Role of 2',6'-dimethyl-l-tyrosine (Dmt) in some opioid lead compounds. | ||||
REF 72 | J Med Chem. 2005 Dec 29;48(26):8112-4.Conversion of the potent delta-opioid agonist H-Dmt-Tic-NH-CH(2)-bid into delta-opioid antagonists by N(1)-benzimidazole alkylation(1). | ||||
REF 73 | J Med Chem. 2007 Jun 14;50(12):2753-66. Epub 2007 May 12.Bifunctional [2',6'-dimethyl-L-tyrosine1]endomorphin-2 analogues substituted at position 3 with alkylated phenylalanine derivatives yield potent mixed mu-agonist/delta-antagonist and dual mu-agonist/delta-agonist opioid ligands. | ||||
REF 74 | J Med Chem. 2007 Feb 8;50(3):512-20.Synthesis and characterization of potent and selective mu-opioid receptor antagonists, [Dmt(1), D-2-Nal(4)]endomorphin-1 (Antanal-1) and [Dmt(1), D-2-Nal(4)]endomorphin-2 (Antanal-2). | ||||
REF 75 | Bioorg Med Chem Lett. 2010 Mar 1;20(5):1601-3. Epub 2010 Jan 22.Synthesis and evaluation of opioid receptor-binding affinity of elaeocarpenine and its analogs. | ||||
REF 76 | Eur J Med Chem. 2010 Oct;45(10):4594-600. Epub 2010 Jul 21.Synthesis and activity of endomorphin-2 and morphiceptin analogues with proline surrogates in position 2. | ||||
REF 77 | J Med Chem. 2008 Jul 24;51(14):4270-9. Epub 2008 Jun 24.New endomorphin analogues containing alicyclic beta-amino acids: influence on bioactive conformation and pharmacological profile. | ||||
REF 78 | J Med Chem. 1990 Sep;33(9):2456-64.Photoactivatable opiate derivatives as irreversible probes of the mu-opioid receptor. | ||||
REF 79 | Bioorg Med Chem. 2008 Mar 15;16(6):3218-23. Epub 2007 Dec 31.Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors. | ||||
REF 80 | J Med Chem. 2003 Jul 3;46(14):3127-37.Identification of (3R)-7-hydroxy-N-((1S)-1-[[(3R,4R)-4-(3-hydroxyphenyl)- 3,4-dimethyl-1-piperidinyl]methyl]-2-methylpropyl)-1,2,3,4-tetrahydro- 3-isoquinolinecarboxamide as a novel potent and selective opioid kappa receptor antagonist. | ||||
REF 81 | J Med Chem. 2009 Nov 12;52(21):6941-5.Agonist vs antagonist behavior of delta opioid peptides containing novel phenylalanine analogues in place of Tyr(1). | ||||
REF 82 | Bioorg Med Chem Lett. 2007 May 1;17(9):2656-60. Epub 2007 Feb 2.Further studies of tyrosine surrogates in opioid receptor peptide ligands. | ||||
REF 83 | J Med Chem. 2000 Feb 24;43(4):569-80.Opiate aromatic pharmacophore structure-activity relationships in CTAP analogues determined by topographical bias, two-dimensional NMR, and biological activity assays. | ||||
REF 84 | J Med Chem. 2006 Jun 29;49(13):3990-3.New 2',6'-dimethyl-L-tyrosine (Dmt) opioid peptidomimetics based on the Aba-Gly scaffold. Development of unique mu-opioid receptor ligands. | ||||
REF 85 | J Med Chem. 2005 Aug 25;48(17):5608-11.From the potent and selective mu opioid receptor agonist H-Dmt-d-Arg-Phe-Lys-NH(2) to the potent delta antagonist H-Dmt-Tic-Phe-Lys(Z)-OH. | ||||
REF 86 | J Med Chem. 2007 Jan 25;50(2):328-33.Beta-methyl substitution of cyclohexylalanine in Dmt-Tic-Cha-Phe peptides results in highly potent delta opioid antagonists. | ||||
REF 87 | J Med Chem. 2008 Aug 28;51(16):5109-17. Epub 2008 Aug 5.Further studies on lead compounds containing the opioid pharmacophore Dmt-Tic. | ||||
REF 88 | J Med Chem. 2004 Dec 16;47(26):6541-6.Highly selective fluorescent analogue of the potent delta-opioid receptor antagonist Dmt-Tic. | ||||
REF 89 | J Med Chem. 2006 Sep 7;49(18):5610-7.Effect of lysine at C-terminus of the Dmt-Tic opioid pharmacophore. | ||||
REF 90 | Bioorg Med Chem Lett. 2005 Dec 15;15(24):5517-20. Epub 2005 Sep 23.New series of potent delta-opioid antagonists containing the H-Dmt-Tic-NH-hexyl-NH-R motif. | ||||
REF 91 | Bioorg Med Chem. 2008 Mar 15;16(6):3032-8. Epub 2007 Dec 23.Role of benzimidazole (Bid) in the delta-opioid agonist pseudopeptide H-Dmt-Tic-NH-CH(2)-Bid (UFP-502). | ||||
REF 92 | Bioorg Med Chem. 2007 Nov 15;15(22):6876-81. Epub 2007 Aug 29.A new opioid designed multiple ligand derived from the micro opioid agonist endomorphin-2 and the delta opioid antagonist pharmacophore Dmt-Tic. | ||||
REF 93 | J Med Chem. 2007 Mar 22;50(6):1414-7. Epub 2007 Feb 22.Dicarba analogues of the cyclic enkephalin peptides H-Tyr-c[D-Cys-Gly-Phe-D(or L)-Cys]NH(2) retain high opioid activity. | ||||
REF 94 | J Med Chem. 1991 Oct;34(10):3125-32.Conformational restriction of the phenylalanine residue in a cyclic opioid peptide analogue: effects on receptor selectivity and stereospecificity. | ||||
REF 95 | J Med Chem. 2008 Mar 13;51(5):1369-76. Epub 2008 Feb 12.A structure-activity relationship study and combinatorial synthetic approach of C-terminal modified bifunctional peptides that are delta/mu opioid receptor agonists and neurokinin 1 receptor antagonists. | ||||
REF 96 | J Med Chem. 2007 Jun 14;50(12):2779-86. Epub 2007 May 22.Design, synthesis, and biological evaluation of novel bifunctional C-terminal-modified peptides for delta/mu opioid receptor agonists and neurokinin-1 receptor antagonists. | ||||
REF 97 | J Med Chem. 2006 Mar 9;49(5):1773-80.Design and synthesis of novel hydrazide-linked bifunctional peptides as delta/mu opioid receptor agonists and CCK-1/CCK-2 receptor antagonists. | ||||
REF 98 | J Med Chem. 2007 Jan 11;50(1):165-8.Partial retro-inverso, retro, and inverso modifications of hydrazide linked bifunctional peptides for opioid and cholecystokinin (CCK) receptors. | ||||
REF 99 | J Med Chem. 2008 Apr 24;51(8):2571-4. Epub 2008 Mar 28.Blood-brain barrier penetration by two dermorphin tetrapeptide analogues: role of lipophilicity vs structural flexibility. | ||||
REF 100 | J Med Chem. 2008 Apr 24;51(8):2421-31. Epub 2008 Apr 2.Herkinorin analogues with differential beta-arrestin-2 interactions. | ||||
REF 101 | J Med Chem. 2009 Nov 12;52(21):6814-21.The effects of C-terminal modifications on the opioid activity of [N-benzylTyr(1)]dynorphin A-(1-11) analogues. | ||||
REF 102 | J Med Chem. 2006 Sep 7;49(18):5597-609.Highly potent and selective phenylmorphan-based inverse agonists of the opioid delta receptor. | ||||
REF 103 | Bioorg Med Chem Lett. 2005 May 16;15(10):2647-52.Arylacetamide kappa opioid receptor agonists with reduced cytochrome P450 2D6 inhibitory activity. | ||||
REF 104 | J Nat Prod. 2007 May;70(5):872-5. Epub 2007 Apr 24.Indolizidine alkaloids with delta-opioid receptor binding affinity from the leaves of Elaeocarpus fuscoides. | ||||
REF 105 | J Med Chem. 1982 Aug;25(8):913-9.Potential affinity labels for the opiate receptor based on fentanyl and related compounds. | ||||
REF 106 | J Nat Prod. 2006 Apr;69(4):640-4.Lophocladines, bioactive alkaloids from the red alga Lophocladia sp. | ||||
REF 107 | J Med Chem. 1998 May 21;41(11):1980-90.Investigation of the N-substituent conformation governing potency and mu receptor subtype-selectivity in (+)-(3R, 4R)-dimethyl-4-(3-hydroxyphenyl)piperidine opioid antagonists. | ||||
REF 108 | J Med Chem. 2009 Nov 12;52(21):6926-30.14beta-Arylpropiolylamino-17-cyclopropylmethyl-7,8-dihydronormorphinones and related opioids. Further examples of pseudoirreversible mu opioid receptor antagonists. | ||||
REF 109 | J Med Chem. 2009 Dec 10;52(23):7389-96.Univalent and bivalent ligands of butorphan: characteristics of the linking chain determine the affinity and potency of such opioid ligands. | ||||
REF 110 | Bioorg Med Chem. 2007 Jun 15;15(12):4106-12. Epub 2007 Mar 30.In-vitro investigation of oxazol and urea analogues of morphinan at opioid receptors. | ||||
REF 111 | Bioorg Med Chem Lett. 2007 Mar 15;17(6):1508-11. Epub 2007 Jan 17.High-affinity carbamate analogues of morphinan at opioid receptors. | ||||
REF 112 | J Med Chem. 2006 Sep 7;49(18):5640-3.New opioid designed multiple ligand from Dmt-Tic and morphinan pharmacophores. | ||||
REF 113 | Bioorg Med Chem Lett. 2009 Jan 1;19(1):203-8. Epub 2008 Nov 7.Syntheses and opioid receptor binding properties of carboxamido-substituted opioids. | ||||
REF 114 | Bioorg Med Chem. 2007 Feb 15;15(4):1694-702. Epub 2006 Dec 12.Endomorphin-1 analogs with enhanced metabolic stability and systemic analgesic activity: design, synthesis, and pharmacological characterization. | ||||
REF 115 | Eur J Med Chem. 2008 Nov;43(11):2307-15. Epub 2008 Feb 29.Ligand binding to nucleic acids and proteins: Does selectivity increase with strength?. | ||||
REF 116 | J Nat Prod. 2007 Dec;70(12):1946-50. Epub 2007 Nov 27.Alkaloids with human delta-opioid receptor binding affinity from the Australian rainforest tree Peripentadenia mearsii. | ||||
REF 117 | J Med Chem. 2007 Aug 9;50(16):3765-76. Epub 2007 Jul 11.Probes for narcotic receptor mediated phenomena. 34. Synthesis and structure-activity relationships of a potent mu-agonist delta-antagonist and an exceedingly potent antinociceptive in the enantiomeric C9-substituted 5-(3-hydroxyphenyl)-N-phenylethylmorphan series. | ||||
REF 118 | Bioorg Med Chem Lett. 2009 May 15;19(10):2792-5. Epub 2009 Mar 26.Design and synthesis of novel delta opioid receptor agonists and their pharmacologies. | ||||
REF 119 | Bioorg Med Chem Lett. 2010 Nov 1;20(21):6302-5. Epub 2010 Aug 21.Design and synthesis of KNT-127, a |A-opioid receptor agonist effective by systemic administration. | ||||
REF 120 | J Med Chem. 2006 May 18;49(10):2868-75.Structure-activity relationships of bifunctional peptides based on overlapping pharmacophores at opioid and cholecystokinin receptors. | ||||
REF 121 | Molecular Mechanisms of Opioid Receptor-Dependent Signaling and Behavior. Anesthesiology. 2011 December; 115(6): 1363-1381. | ||||
REF 122 | J Med Chem. 1993 Mar 19;36(6):708-19.A topochemical approach to explain morphiceptin bioactivity. | ||||
REF 123 | J Med Chem. 2008 Jan 10;51(1):173-7. Epub 2007 Dec 7.Endomorphin-2 with a beta-turn backbone constraint retains the potent micro-opioid receptor agonist properties. | ||||
REF 124 | J Med Chem. 2008 Oct 23;51(20):6334-47. Epub 2008 Sep 27.The importance of micelle-bound states for the bioactivities of bifunctional peptide derivatives for delta/mu opioid receptor agonists and neurokinin 1 receptor antagonists. | ||||
REF 125 | J Med Chem. 1997 Aug 29;40(18):2948-52.Synthesis and pharmacological activity of deltorphin and dermorphin-related glycopeptides. | ||||
REF 126 | J Med Chem. 1994 Jan 7;37(1):141-5.Design of cyclic deltorphins and dermenkephalins with a disulfide bridge leads to analogues with high selectivity for delta-opioid receptors. | ||||
REF 127 | Bioorg Med Chem Lett. 2006 Jul 15;16(14):3688-92. Epub 2006 May 8.Opioid receptor binding and antinociceptive activity of the analogues of endomorphin-2 and morphiceptin with phenylalanine mimics inthe position 3 or 4. | ||||
REF 128 | Bioorg Med Chem. 2008 Jun 15;16(12):6415-22. Epub 2008 May 3.Structure-activity study of endomorphin-2 analogs with C-terminal modifications by NMR spectroscopy and molecular modeling. | ||||
REF 129 | J Med Chem. 2010 Apr 8;53(7):2875-81."Carba"-analogues of fentanyl are opioid receptor agonists. | ||||
REF 130 | Subramanian G, Paterlini MG, Portoghese PS, Ferguson DM: Molecular docking reveals a novel binding site model for fentanyl at the mu-opioid receptor. J Med Chem. 2000 Feb 10;43(3):381-91. | ||||
REF 131 | You HJ, Colpaert FC, Arendt-Nielsen L: The novel analgesic and high-efficacy 5-HT1A receptor agonist F 13640 inhibits nociceptive responses, wind-up, and after-discharges in spinal neurons and withdrawal reflexes. Exp Neurol. 2005 Jan;191(1):174-83. | ||||
REF 132 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 317). | ||||
REF 133 | Preclinical pharmacology of AZD2327: a highly selective agonist of the delta-opioid receptor. J Pharmacol Exp Ther. 2011 Jul;338(1):195-204. | ||||
REF 134 | Cross-linking of human [125I]beta-endorphin to opioid receptors in rat striatal membranes: biochemical evidence for the existence of a mu/delta opioid receptor complex. J Pharmacol Exp Ther. 1990 Apr;253(1):419-26. | ||||
REF 135 | Butorphanol: effects of a prototypical agonist-antagonist analgesic on kappa-opioid receptors. J Pharmacol Sci. 2005 Jun;98(2):109-16. Epub 2005 Jun 8. | ||||
REF 136 | BW373U86, a delta opioid agonist, partially mediates delayed cardioprotection via a free radical mechanism that is independent of opioid receptor stimulation. J Mol Cell Cardiol. 2001 Aug;33(8):1455-65. | ||||
REF 137 | Wax PM, Becker CE, Curry SC: Unexpected “gas” casualties in Moscow: a medical toxicology perspective. Ann Emerg Med. 2003 May;41(5):700-5. | ||||
REF 138 | Delta opioid receptor stimulation mimics ischemic preconditioning in human heart muscle. J Am Coll Cardiol. 2000 Dec;36(7):2296-302. | ||||
REF 139 | Opiate receptor binding properties of morphine-, dihydromorphine-, and codeine 6-O-sulfate ester congeners. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4291-5. Epub 2006 Jun 13. | ||||
REF 140 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 141 | DPI-3290 [(+)-3-((alpha-R)-alpha-((2S,5R)-4-Allyl-2,5-dimethyl-1-piperazinyl)-3-hydroxybenzyl)-N-(3-fluorophenyl)-N-methylbenzamide]. II. A mixed opioid agonist with potent antinociceptive activity and limited effects on respiratory function. J Pharmacol Exp Ther. 2003 Dec;307(3):1227-33. Epub 2003 Oct 8. | ||||
REF 142 | [3H][D-Ser2(O-tert-butyl),Leu5]enkephalyl-Thr6 and [D-Ser2(O-tert-butyl),Leu5]enkephalyl-Thr6(O-tert-butyl). Two new enkephalin analogs with both a good selectivity and a high affinity toward delta-opioid binding sites. J Biol Chem. 1988 Mar 25;263(9):4124-30. | ||||
REF 143 | Cloning and functional comparison of kappa and delta opioid receptors from mouse brain. Proc Natl Acad Sci U S A. 1993 Jul 15;90(14):6736-40. | ||||
REF 144 | Agonist-, antagonist-, and inverse agonist-regulated trafficking of the delta-opioid receptor correlates with, but does not require, G protein activation. J Pharmacol Exp Ther. 2001 Sep;298(3):1015-20. | ||||
REF 145 | Inverse agonist action of Leu-enkephalin at delta(2)-opioid receptors mediates spinal antianalgesia. J Pharmacol Exp Ther. 2001 May;297(2):582-9. | ||||
REF 146 | US patent application no. 6,924,288, Enantiomerically pure opioid diarylmethylpiperzine and methods of using same. | ||||
REF 147 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018026) | ||||
REF 148 | Delta-opioid receptor agonists inhibit neuromuscular transmission in human colon. Eur J Pharmacol. 1994 Sep 1;262(1-2):33-9. | ||||
REF 149 | Oxycodone: a pharmacological and clinical review. Clin Transl Oncol. 2007 May;9(5):298-307. | ||||
REF 150 | The antitussive activity of delta-opioid receptor stimulation in guinea pigs. J Pharmacol Exp Ther. 2000 Feb;292(2):803-9. | ||||
REF 151 | Antiparkinson potential of delta-opioid receptor agonists. Eur J Pharmacol. 2000 May 19;396(2-3):101-7. | ||||
REF 152 | Nonpeptidic delta-opioid receptor agonists reduce immobility in the forced swim assay in rats. Neuropsychopharmacology. 2002 Jun;26(6):744-55. | ||||
REF 153 | Delta-opioid receptor antagonists as a new concept for central acting antitussive drugs. Pulm Pharmacol Ther. 2002;15(3):235-40. | ||||
REF 154 | [6-O-methyl-11C]Diprenorphine, Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013. 2006 May 24 [updated 2007 May 12]. | ||||
REF 155 | In vivo evidence for the selectivity of ICI 154129 for the delta-opioid receptor. Neuropharmacology. 1985 Feb;24(2):107-10. | ||||
REF 156 | Differential antagonism of delta opioid agonists by naltrindole and its benzofuran analog (NTB) in mice: evidence for delta opioid receptor subtypes. J Pharmacol Exp Ther. 1991 May;257(2):676-80. | ||||
REF 157 | In vivo pharmacological characterization of SoRI 9409, a nonpeptidic opioid mu-agonist/delta-antagonist that produces limited antinociceptive tolerance and attenuates morphine physical dependence. J Pharmacol Exp Ther. 2001 May;297(2):597-605. | ||||
REF 158 | The TIPP opioid peptide family: development of delta antagonists, delta agonists, and mixed mu agonist/delta antagonists. Biopolymers. 1999;51(6):411-25. | ||||
REF 159 | TIPP[psi]: a highly potent and stable pseudopeptide delta opioid receptor antagonist with extraordinary delta selectivity. J Med Chem. 1993 Oct 15;36(21):3182-7. | ||||
REF 160 | Design and synthesis of a metabolically stable and potent antitussive agent, a novel delta opioid receptor antagonist, TRK-851. Bioorg Med Chem. 2008 Sep 1;16(17):7956-67. | ||||
REF 161 | Selective in vivo binding of [3H]naltriben to delta-opioid receptors in mouse brain. Eur J Pharmacol. 1998 Jun 5;350(2-3):335-44. | ||||
REF 162 | Characterization of [3H]naltrindole binding to delta opioid receptors in rat brain. Life Sci. 1992;50(16):PL119-24. | ||||
REF 163 | Mutation W284L of the human delta opioid receptor reveals agonist specific receptor conformations for G protein activation. Life Sci. 2001 Apr 6;68(19-20):2233-42. | ||||
REF 164 | Identification of opioid ligands possessing mixed micro agonist/delta antagonist activity among pyridomorphinans derived from naloxone, oxymorphone, and hydromorphone [correction of hydropmorphone]. J Med Chem. 2004 Mar 11;47(6):1400-12. | ||||
REF 165 | Loperamide: evidence of interaction with mu and delta opioid receptors. Life Sci. 1983;33 Suppl 1:315-8. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.