Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T96144
(Former ID: TTDS00080)
|
|||||
| Target Name |
DNA topoisomerase II (TOP2)
|
|||||
| Synonyms |
TOP2; DNA topoisomerase 2
Click to Show/Hide
|
|||||
| Gene Name |
TOP2A; TOP2B
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 15 Target-related Diseases | + | ||||
| 1 | Acute myeloid leukaemia [ICD-11: 2A60] | |||||
| 2 | Anogenital warts [ICD-11: 1A95] | |||||
| 3 | Bacterial infection [ICD-11: 1A00-1C4Z] | |||||
| 4 | Bladder cancer [ICD-11: 2C94] | |||||
| 5 | Breast cancer [ICD-11: 2C60-2C6Y] | |||||
| 6 | Chemoprotection [ICD-11: N.A.] | |||||
| 7 | Common warts [ICD-11: 1E80] | |||||
| 8 | Gonococcal infection [ICD-11: 1A70-1A7Z] | |||||
| 9 | HIV-infected patients with tuberculosis [ICD-11: 1B10-1B14] | |||||
| 10 | Mature B-cell lymphoma [ICD-11: 2A85] | |||||
| 11 | Otitis externa [ICD-11: AA00-AA13] | |||||
| 12 | Otitis media [ICD-11: AA80-AB0Z] | |||||
| 13 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| 14 | Syphilis [ICD-11: 1A61-1A6Z] | |||||
| 15 | Urinary tract infection [ICD-11: GC08] | |||||
| Function |
Cut both strands of the DNA helix simultaneously in order to manage DNA tangles and supercoils.
Click to Show/Hide
|
|||||
| BioChemical Class |
ATP-hydrolyzing DNA topoisomerase
|
|||||
| UniProt ID | ||||||
| Sequence |
MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQ
MWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWN NGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE TASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMV RRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVC LTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHM WIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDK YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMT DQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKS STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDD RKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVD GLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNN LNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEW YIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIE ELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREY HTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILR DFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQR GYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEK KDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA KGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQ RLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRA ATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLE ADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKG TKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHM DFDSAVAPRAKSVRAKKPIKYLEESDEDDLF Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 23 Approved Drugs | + | ||||
| 1 | Aclarubicin | Drug Info | Approved | Acute myeloid leukaemia | [2], [3] | |
| 2 | Amsacrine | Drug Info | Approved | Acute lymphoblastic leukaemia | [4] | |
| 3 | Cinoxacin | Drug Info | Approved | Urinary tract infection | [3], [5] | |
| 4 | Ciprofloxacin+dexamethasone | Drug Info | Approved | Otitis externa | [6] | |
| 5 | Dexrazoxane | Drug Info | Approved | Breast cancer | [7], [8] | |
| 6 | Dhaq diacetate | Drug Info | Approved | Solid tumour/cancer | [9] | |
| 7 | Doxorubicin | Drug Info | Approved | Solid tumour/cancer | [2], [10] | |
| 8 | Enoxacin | Drug Info | Approved | Urinary tract infection | [3], [11] | |
| 9 | Epirubicin | Drug Info | Approved | Solid tumour/cancer | [12] | |
| 10 | Etoposide | Drug Info | Approved | Solid tumour/cancer | [2], [13] | |
| 11 | Fleroxacin | Drug Info | Approved | Bacterial infection | [14] | |
| 12 | Idarubicin | Drug Info | Approved | Acute myeloid leukaemia | [12], [15] | |
| 13 | Lomefloxacin | Drug Info | Approved | Bacterial infection | [16] | |
| 14 | Lucanthone | Drug Info | Approved | Solid tumour/cancer | [17] | |
| 15 | Mitoxantrone | Drug Info | Approved | Solid tumour/cancer | [18], [19] | |
| 16 | Nalidixic Acid | Drug Info | Approved | Urinary tract infection | [3], [20] | |
| 17 | Novobiocin | Drug Info | Approved | Bacterial infection | [21] | |
| 18 | Pefloxacin | Drug Info | Approved | Gonococcal urethritis | [22] | |
| 19 | Podofilox | Drug Info | Approved | External genital and perianal wart | [3] | |
| 20 | Quinolones | Drug Info | Approved | Bacterial infection | [23] | |
| 21 | Rosoxacin | Drug Info | Approved | Bacterial infection | [24] | |
| 22 | Teniposide | Drug Info | Approved | Acute lymphoblastic leukaemia | [2], [25] | |
| 23 | Valrubicin | Drug Info | Approved | Bladder cancer | [2] | |
| Clinical Trial Drug(s) | [+] 28 Clinical Trial Drugs | + | ||||
| 1 | Aldoxorubicin | Drug Info | Phase 3 | Soft tissue sarcoma | [26], [27] | |
| 2 | GSK2140944 | Drug Info | Phase 3 | Urinary tract infection | [28] | |
| 3 | Pixantrone | Drug Info | Phase 3 | Multiple sclerosis | [29], [30] | |
| 4 | SNS-595 | Drug Info | Phase 3 | Acute myeloid leukaemia | [31] | |
| 5 | Tirapazamine | Drug Info | Phase 3 | Alzheimer disease | [32] | |
| 6 | MTC-DOX | Drug Info | Phase 2/3 | Liver cancer | [33] | |
| 7 | 13-DEOXYADRIAMYCIN HYDROCHLORIDE | Drug Info | Phase 2 | Solid tumour/cancer | [34] | |
| 8 | Berubicin | Drug Info | Phase 2 | Solid tumour/cancer | [35] | |
| 9 | CAP-7.1 | Drug Info | Phase 2 | Solid tumour/cancer | [36] | |
| 10 | Doxorubicin-eluting beads | Drug Info | Phase 2 | Liver cancer | [37] | |
| 11 | Elsamitrucin | Drug Info | Phase 2 | Solid tumour/cancer | [38] | |
| 12 | GPX-150D | Drug Info | Phase 2 | Breast cancer | [39] | |
| 13 | PYRAZOLOACRIDINE | Drug Info | Phase 2 | Colorectal cancer | [40] | |
| 14 | Sabarubicin | Drug Info | Phase 2 | Solid tumour/cancer | [41] | |
| 15 | Salvicine | Drug Info | Phase 2 | Solid tumour/cancer | [42] | |
| 16 | XR-5000 | Drug Info | Phase 2 | Colorectal cancer | [43] | |
| 17 | F-14512 | Drug Info | Phase 1/2 | Solid tumour/cancer | [44] | |
| 18 | L-377202 | Drug Info | Phase 1/2 | Solid tumour/cancer | [45] | |
| 19 | AjvW2 | Drug Info | Phase 1 | Thrombosis | [46] | |
| 20 | BMY-43748 | Drug Info | Phase 1 | Bacterial infection | [47] | |
| 21 | Daniquidone | Drug Info | Phase 1 | Lymphoma | [48] | |
| 22 | GRC-6211 | Drug Info | Phase 1 | Asthma | [49] | |
| 23 | Iboctadekin + Doxil | Drug Info | Phase 1 | Ovarian cancer | [50], [51] | |
| 24 | MLN-576 | Drug Info | Phase 1 | Acute lymphoblastic leukaemia | [52] | |
| 25 | NK-314 | Drug Info | Phase 1 | Solid tumour/cancer | [53] | |
| 26 | Tafluposide | Drug Info | Phase 1 | Solid tumour/cancer | [54] | |
| 27 | TAS-103 | Drug Info | Phase 1 | Solid tumour/cancer | [55] | |
| 28 | XR-5944 | Drug Info | Phase 1 | Gastric adenocarcinoma | [56] | |
| Discontinued Drug(s) | [+] 17 Discontinued Drugs | + | ||||
| 1 | BW-773U82 | Drug Info | Discontinued in Phase 2 | Solid tumour/cancer | [57] | |
| 2 | ELINAFIDE MESILATE | Drug Info | Discontinued in Phase 2 | Solid tumour/cancer | [58] | |
| 3 | GL-331 | Drug Info | Discontinued in Phase 2 | Colorectal cancer | [59] | |
| 4 | KW-2170 | Drug Info | Discontinued in Phase 2 | Breast cancer | [60] | |
| 5 | LOSOXANTRONE | Drug Info | Discontinued in Phase 2 | Breast cancer | [61] | |
| 6 | Merbarone | Drug Info | Discontinued in Phase 2 | Pancreatic cancer | [62] | |
| 7 | Mitonafide | Drug Info | Discontinued in Phase 2 | Solid tumour/cancer | [63] | |
| 8 | NC-190 | Drug Info | Discontinued in Phase 2 | Solid tumour/cancer | [64] | |
| 9 | SUPER-LEU-DOX | Drug Info | Discontinued in Phase 2 | Solid tumour/cancer | [65] | |
| 10 | Banoxantrone | Drug Info | Discontinued in Phase 1 | Acute lymphoblastic leukaemia | [66] | |
| 11 | Teloxantrone | Drug Info | Discontinued in Phase 1 | Solid tumour/cancer | [67] | |
| 12 | TOP-53 | Drug Info | Discontinued in Phase 1 | Metastatic lung cancer | [68] | |
| 13 | A-74932 | Drug Info | Terminated | Lung cancer | [70] | |
| 14 | BE-22179 | Drug Info | Terminated | leukaemia | [71] | |
| 15 | Datelliptium chloride | Drug Info | Terminated | Breast cancer | [72] | |
| 16 | Doxorubicin-CEA conjugate | Drug Info | Terminated | Breast cancer | [73] | |
| 17 | Garenoxacin | Drug Info | Terminated | Endocarditis | [74] | |
| Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
| 1 | Nemorubicin | Drug Info | Preclinical | Solid tumour/cancer | [69] | |
| Mode of Action | [+] 4 Modes of Action | + | ||||
| Inhibitor | [+] 50 Inhibitor drugs | + | ||||
| 1 | Aclarubicin | Drug Info | [75], [76] | |||
| 2 | Amsacrine | Drug Info | [1] | |||
| 3 | Cinoxacin | Drug Info | [77] | |||
| 4 | Dhaq diacetate | Drug Info | [9], [78] | |||
| 5 | Enoxacin | Drug Info | [79] | |||
| 6 | Fleroxacin | Drug Info | [81] | |||
| 7 | Lomefloxacin | Drug Info | [82] | |||
| 8 | Lucanthone | Drug Info | [83] | |||
| 9 | Nalidixic Acid | Drug Info | [85] | |||
| 10 | Novobiocin | Drug Info | [86] | |||
| 11 | Pefloxacin | Drug Info | [79] | |||
| 12 | Quinolones | Drug Info | [89] | |||
| 13 | Rosoxacin | Drug Info | [90] | |||
| 14 | Valrubicin | Drug Info | [91] | |||
| 15 | GSK2140944 | Drug Info | [93] | |||
| 16 | AjvW2 | Drug Info | [99] | |||
| 17 | GRC-6211 | Drug Info | [85] | |||
| 18 | Iboctadekin + Doxil | Drug Info | [101] | |||
| 19 | Amifloxacin | Drug Info | [85] | |||
| 20 | ELINAFIDE MESILATE | Drug Info | [3], [107] | |||
| 21 | A-62176 | Drug Info | [119] | |||
| 22 | ER-37328 | Drug Info | [123] | |||
| 23 | Garenoxacin | Drug Info | [124] | |||
| 24 | 1,3,7-trihydroxyacridone | Drug Info | [76] | |||
| 25 | 1-Methoxy-3-(oxiran-2-ylmethoxy)-9H-xanthen-9-one | Drug Info | [125] | |||
| 26 | 2-(2-Aminoethyl)anthra[1,9-cd]pyrazol-6(2H)-one | Drug Info | [126] | |||
| 27 | 2-(2-Hydroxyethyl)anthra[1,9-cd]pyrazol-6(2H)-one | Drug Info | [126] | |||
| 28 | 3,3'-(4-phenylpyridine-2,6-diyl)diphenol | Drug Info | [127] | |||
| 29 | 3-(2,6-diphenylpyridin-4-yl)phenol | Drug Info | [127] | |||
| 30 | 3-(2-phenyl-6-(thiophen-2-yl)pyridin-4-yl)-phenol | Drug Info | [127] | |||
| 31 | 3-(2-phenyl-6-(thiophen-3-yl)pyridin-4-yl)-phenol | Drug Info | [127] | |||
| 32 | 3-(4-phenyl-6-(thiophen-2-yl)pyridin-2-yl)-phenol | Drug Info | [127] | |||
| 33 | 3-(4-phenyl-6-(thiophen-3-yl)pyridin-2-yl)-phenol | Drug Info | [127] | |||
| 34 | 3-(6-(furan-2-yl)-4-phenylpyridin-2-yl)-phenol | Drug Info | [127] | |||
| 35 | 4'-Demethyl-4beta-amino-4-desoxypodophyllotoxin | Drug Info | [128] | |||
| 36 | 4'-Demethyl-epipodophyllotoxin | Drug Info | [128] | |||
| 37 | 4,4'-(4-phenylpyridine-2,6-diyl)diphenol | Drug Info | [127] | |||
| 38 | 4-(furan-3-yl)-2,6-di(thiophen-2-yl)pyridine | Drug Info | [129] | |||
| 39 | 7-chloro-1,3-dihydroxyacridone | Drug Info | [76] | |||
| 40 | AMP-PNP | Drug Info | [131] | |||
| 41 | Clorobiocin | Drug Info | [132] | |||
| 42 | DEMETHYLZEYLASTERONE | Drug Info | [133] | |||
| 43 | Ellipticine | Drug Info | [135] | |||
| 44 | Howiinol A (GHM-10) | Drug Info | [136] | |||
| 45 | ICRF-154 | Drug Info | [99] | |||
| 46 | LUPEOL | Drug Info | [137] | |||
| 47 | Makaluvamine N | Drug Info | [138] | |||
| 48 | Olean-12-en-3beta,15alpha-diol | Drug Info | [137] | |||
| 49 | Pumiliotoxin 251D | Drug Info | [21] | |||
| 50 | TOPOSTATIN | Drug Info | [139] | |||
| Binder | [+] 1 Binder drugs | + | ||||
| 1 | Ciprofloxacin+dexamethasone | Drug Info | [6] | |||
| Modulator | [+] 50 Modulator drugs | + | ||||
| 1 | Dexrazoxane | Drug Info | [23] | |||
| 2 | Doxorubicin | Drug Info | [23] | |||
| 3 | Epirubicin | Drug Info | [23] | |||
| 4 | Etoposide | Drug Info | [80] | |||
| 5 | Idarubicin | Drug Info | [23] | |||
| 6 | Mitoxantrone | Drug Info | [84] | |||
| 7 | Podofilox | Drug Info | [87], [88] | |||
| 8 | Teniposide | Drug Info | [23] | |||
| 9 | Aldoxorubicin | Drug Info | [92] | |||
| 10 | Pixantrone | Drug Info | [92] | |||
| 11 | SNS-595 | Drug Info | [94] | |||
| 12 | Tirapazamine | Drug Info | [92] | |||
| 13 | MTC-DOX | Drug Info | [92] | |||
| 14 | 13-DEOXYADRIAMYCIN HYDROCHLORIDE | Drug Info | [92] | |||
| 15 | Berubicin | Drug Info | [92] | |||
| 16 | CAP-7.1 | Drug Info | [92] | |||
| 17 | Doxorubicin-eluting beads | Drug Info | [92] | |||
| 18 | Elsamitrucin | Drug Info | [38] | |||
| 19 | GPX-150D | Drug Info | [95] | |||
| 20 | PYRAZOLOACRIDINE | Drug Info | [96] | |||
| 21 | Sabarubicin | Drug Info | [92] | |||
| 22 | Salvicine | Drug Info | [42], [97] | |||
| 23 | XR-5000 | Drug Info | [43] | |||
| 24 | F-14512 | Drug Info | [98] | |||
| 25 | L-377202 | Drug Info | [92] | |||
| 26 | BMY-43748 | Drug Info | [3], [47] | |||
| 27 | Daniquidone | Drug Info | [100] | |||
| 28 | MLN-576 | Drug Info | [52], [102] | |||
| 29 | NK-314 | Drug Info | [103] | |||
| 30 | Tafluposide | Drug Info | [104] | |||
| 31 | TAS-103 | Drug Info | [105] | |||
| 32 | XR-5944 | Drug Info | [56] | |||
| 33 | BW-773U82 | Drug Info | [106] | |||
| 34 | GL-331 | Drug Info | [108], [109] | |||
| 35 | KW-2170 | Drug Info | [110] | |||
| 36 | LOSOXANTRONE | Drug Info | [111] | |||
| 37 | Merbarone | Drug Info | [112] | |||
| 38 | Mitonafide | Drug Info | [113] | |||
| 39 | NC-190 | Drug Info | [114], [115] | |||
| 40 | SUPER-LEU-DOX | Drug Info | [92] | |||
| 41 | Banoxantrone | Drug Info | [92] | |||
| 42 | Teloxantrone | Drug Info | [116] | |||
| 43 | TOP-53 | Drug Info | [117] | |||
| 44 | Nemorubicin | Drug Info | [118] | |||
| 45 | A-74932 | Drug Info | [120] | |||
| 46 | BE-22179 | Drug Info | [121] | |||
| 47 | Datelliptium chloride | Drug Info | [122] | |||
| 48 | Doxorubicin-CEA conjugate | Drug Info | [23] | |||
| 49 | doxorubicin-LL2 conjugate | Drug Info | [134] | |||
| 50 | doxorubicin-peptide-PEG conjugate | Drug Info | [134] | |||
| Intercalator | [+] 1 Intercalator drugs | + | ||||
| 1 | Ametantrone | Drug Info | [130] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| Target QSAR Model | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Design of two etoposide-amsacrine conjugates: topoisomerase II and tubuline polymerization inhibition and relation to cytotoxicity. Anticancer Drug Des. 2000 Dec;15(6):413-21. | |||||
| REF 2 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
| REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 4 | Identification of FDA-approved drugs and bioactives that protect hair cells in the zebrafish (Danio rerio) lateral line and mouse (Mus musculus) ut... J Assoc Res Otolaryngol. 2009 Jun;10(2):191-203. | |||||
| REF 5 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 018067. | |||||
| REF 6 | Emerging therapies for the treatment and prevention of otitis media. Expert Opin Emerg Drugs. 2006 May;11(2):251-64. | |||||
| REF 7 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7330). | |||||
| REF 8 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 076068. | |||||
| REF 9 | The hypoxia-activated ProDrug AQ4N penetrates deeply in tumor tissues and complements the limited distribution of mitoxantrone. Cancer Res. 2009 Feb 1;69(3):940-7. | |||||
| REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7069). | |||||
| REF 11 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 019616. | |||||
| REF 12 | New drugs for the treatment of cancer, 1990-2001. Isr Med Assoc J. 2002 Dec;4(12):1124-31. | |||||
| REF 13 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6815). | |||||
| REF 14 | Drug information of Fleroxacin, Health Canada, 2007. | |||||
| REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7083). | |||||
| REF 16 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 020013. | |||||
| REF 17 | Drug information of Lucanthone, 2008. eduDrugs. | |||||
| REF 18 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7242). | |||||
| REF 19 | Acute promyelocytic leukemic involvement of the optic nerves following mitoxantrone treatment for multiple sclerosis. J Neurol Sci. 2008 Oct 15;273(1-2):144-7. | |||||
| REF 20 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 071919. | |||||
| REF 21 | How many modes of action should an antibiotic have Curr Opin Pharmacol. 2008 Oct;8(5):564-73. | |||||
| REF 22 | Drug information of Pefloxacin, 2008. eduDrugs. | |||||
| REF 23 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
| REF 24 | Drug information of Rosoxacin, 2008. eduDrugs. | |||||
| REF 25 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6843). | |||||
| REF 26 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 27 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 28 | ClinicalTrials.gov (NCT04020341) A Study to Evaluate Efficacy and Safety of Gepotidacin in the Treatment of Uncomplicated Urinary Tract Infection (UTI). U.S. National Institutes of Health. | |||||
| REF 29 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7544). | |||||
| REF 30 | ClinicalTrials.gov (NCT00088530) BBR 2778 for Relapsed, Aggressive Non-Hodgkin's Lymphoma (NHL). U.S. National Institutes of Health. | |||||
| REF 31 | ClinicalTrials.gov (NCT01191801) Study of Vosaroxin or Placebo in Combination With Cytarabine in Patients With First Relapsed or Refractory AML (VALOR). U.S. National Institutes of Health. | |||||
| REF 32 | ClinicalTrials.gov (NCT00262821) Cisplatin and Radiation Therapy With or Without Tirapazamine in Treating Patients With Cervical Cancer. U.S. National Institutes of Health. | |||||
| REF 33 | ClinicalTrials.gov (NCT00034333) Safety and Efficacy of Doxorubicin Adsorbed to Magnetic Beads Vs. IV Doxorubicin in Treating Liver Cancer. U.S. National Institutes of Health. | |||||
| REF 34 | ClinicalTrials.gov (NCT00123877) Study of GPX-100 in the Treatment of Metastatic Breast Cancer. U.S. National Institutes of Health. | |||||
| REF 35 | ClinicalTrials.gov (NCT00538343) RTA 744 in Breast Cancer Patients With Progression of Previously Irradiated Brain Metastases. U.S. National Institutes of Health. | |||||
| REF 36 | ClinicalTrials.gov (NCT02094560) CAP7.1 for the Treatment of Advanced Stage, Therapy Refractory Lung and Biliary Tract Tumors. U.S. National Institutes of Health. | |||||
| REF 37 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026037) | |||||
| REF 38 | Elsamicin A binding to DNA. A comparative thermodynamic characterization. FEBS Lett. 2004 Oct 8;576(1-2):68-72. | |||||
| REF 39 | ClinicalTrials.gov (NCT02267083) Efficacy and Safety Study of GPX-150 to Treat Soft Tissue Sarcoma. U.S. National Institutes of Health. | |||||
| REF 40 | ClinicalTrials.gov (NCT00003802) Pyrazoloacridine in Treating Patients With Metastatic Skin or Eye Melanoma. U.S. National Institutes of Health. | |||||
| REF 41 | ClinicalTrials.gov (NCT00027781) MEN-10755 in Treating Patients With Progressive Prostate Cancer That Has Not Responded to Hormone Therapy. U.S. National Institutes of Health. | |||||
| REF 42 | Salvicine functions as novel topoisomerase II poison by binding to ATP pocket. Mol Pharmacol. 2006 Nov;70(5):1593-601. | |||||
| REF 43 | Phase II study of XR5000 (DACA) administered as a 120-h infusion in patients with recurrent glioblastoma multiforme. Ann Oncol. 2002 May;13(5):777-80. | |||||
| REF 44 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026777) | |||||
| REF 45 | ClinicalTrials.gov (NCT00987753) Study Evaluating the Safety and Tolerability of L-377202. U.S. National Institutes of Health. | |||||
| REF 46 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009728) | |||||
| REF 47 | Comparative metabolism of tosufloxacin and BMY 43748 in hepatocytes from rat, dog, monkey and man. Toxicol In Vitro. 1993 Jul;7(4):499-503. | |||||
| REF 48 | ClinicalTrials.gov (NCT00450502) Safety of Batracylin in Patients With Solid Tumors and Lymphomas. U.S. National Institutes of Health. | |||||
| REF 49 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024886) | |||||
| REF 50 | Clinical pipeline report, company report or official report of GlaxoSmithKline. | |||||
| REF 51 | ClinicalTrials.gov (NCT00659178) Combination Study Of SB-485232 (Interleukin 18) And Doxil For Advanced Stage Epithelial Ovarian Cancer. U.S. National Institutes of Health. | |||||
| REF 52 | In vitro and in vivo characterization of XR11576, a novel, orally active, dual inhibitor of topoisomerase I and II. Anticancer Drugs. 2002 Jan;13(1):15-28. | |||||
| REF 53 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020174) | |||||
| REF 54 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012192) | |||||
| REF 55 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007714) | |||||
| REF 56 | Antitumor activity of XR5944, a novel and potent topoisomerase poison. Anticancer Drugs. 2001 Apr;12(4):359-67. | |||||
| REF 57 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002707) | |||||
| REF 58 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005099) | |||||
| REF 59 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002538) | |||||
| REF 60 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004178) | |||||
| REF 61 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000754) | |||||
| REF 62 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000894) | |||||
| REF 63 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002671) | |||||
| REF 64 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000904) | |||||
| REF 65 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009260) | |||||
| REF 66 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004590) | |||||
| REF 67 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000732) | |||||
| REF 68 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004663) | |||||
| REF 69 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012041) | |||||
| REF 70 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003878) | |||||
| REF 71 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004286) | |||||
| REF 72 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001278) | |||||
| REF 73 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007194) | |||||
| REF 74 | Emerging drugs for bacterial urinary tract infections. Expert Opin Emerg Drugs. 2005 May;10(2):275-98. | |||||
| REF 75 | Linker length in podophyllotoxin-acridine conjugates determines potency in vivo and in vitro as well as specificity against MDR cell lines. Anticancer Drug Des. 2001 Dec;16(6):305-15. | |||||
| REF 76 | 1,3-Dihydroxyacridone derivatives as inhibitors of herpes virus replication. Antiviral Res. 2000 Feb;45(2):123-34. | |||||
| REF 77 | The interaction and transport of beta-lactam antibiotics with the cloned rat renal organic anion transporter 1. J Pharmacol Exp Ther. 1999 Aug;290(2):672-7. | |||||
| REF 78 | Topoisomerase II is required for mitoxantrone to signal nuclear factor kappa B activation in HL60 cells. J Biol Chem. 2000 Aug 18;275(33):25231-8. | |||||
| REF 79 | Clinical pharmacokinetics of the newer antibacterial 4-quinolones. Clin Pharmacokinet. 1988 Feb;14(2):96-121. | |||||
| REF 80 | Etoposide, topoisomerase II and cancer.Curr Med Chem Anticancer Agents.2005 Jul;5(4):363-72. | |||||
| REF 81 | Fleroxacin overview. Chemotherapy. 1996 Mar;42 Suppl 1:1-9. | |||||
| REF 82 | Inhibition of human topoisomerase IIalpha by fluoroquinolones and ultraviolet A irradiation. Toxicol Sci. 2002 Sep;69(1):16-22. | |||||
| REF 83 | Clonogenicity of human leukemic cells protected from cell-lethal agents by heat shock protein 70. Cell Stress Chaperones. 2005 Spring;10(1):37-45. | |||||
| REF 84 | Mitoxantrone, a topoisomerase II inhibitor, induces apoptosis of B-chronic lymphocytic leukaemia cells. Br J Haematol. 1998 Jan;100(1):142-6. | |||||
| REF 85 | Activity of fluoroquinolone antibiotics against Plasmodium falciparum in vitro. Antimicrob Agents Chemother. 1988 Aug;32(8):1182-6. | |||||
| REF 86 | Transcriptional responses of Bacillus subtillis and thuringiensis to antibiotics and anti-tumour drugs. Int J Mol Med. 2009 Jan;23(1):33-9. | |||||
| REF 87 | Antitumor properties of podophyllotoxin and related compounds. Curr Pharm Des. 2000 Dec;6(18):1811-39. | |||||
| REF 88 | Identification of therapeutic candidates for chronic lymphocytic leukemia from a library of approved drugs.PLoS One.2013 Sep 20;8(9):e75252. | |||||
| REF 89 | The magic bullets and tuberculosis drug targets. Annu Rev Pharmacol Toxicol. 2005;45:529-64. | |||||
| REF 90 | Inhibition of Micrococcus luteus DNA gyrase by norfloxacin and 10 other quinolone carboxylic acids. Antimicrob Agents Chemother. 1986 Apr;29(4):598-601. | |||||
| REF 91 | Metabolic activation of N-acylanthracyclines precedes their interaction with DNA topoisomerase II. NCI Monogr. 1987;(4):111-5. | |||||
| REF 92 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
| REF 93 | Determination of disk diffusion and MIC quality control guidelines for GSK2140944, a novel bacterial type II topoisomerase inhibitor antimicrobial agent. J Clin Microbiol. 2014 Jul;52(7):2629-32. | |||||
| REF 94 | A phase 1b/2 study of vosaroxin in combination with cytarabine in patients with relapsed or refractory acute myeloid leukemia.Haematologica.2015 Feb;100(2):231-7. | |||||
| REF 95 | Company report (Gem pharmaceuticals) | |||||
| REF 96 | Effect of pyrazoloacridine (NSC 366140) on DNA topoisomerases I and II. Clin Cancer Res. 1998 Mar;4(3):683-91. | |||||
| REF 97 | Salvicine, a novel topoisomerase II inhibitor, exerts its potent anticancer activity by ROS generation. Acta Pharmacol Sin. 2007 Sep;28(9):1460-5. | |||||
| REF 98 | Regulation by survivin of cancer cell death induced by F14512, a polyamine-containing inhibitor of DNA topoisomerase II.Apoptosis.2012 Apr;17(4):364-76. | |||||
| REF 99 | The catalytic DNA topoisomerase II inhibitor ICRF-193 and all-trans retinoic acid cooperatively induce granulocytic differentiation of acute promyelocytic leukemia cells: candidate drugs for chemo-differentiation therapy against acute promyelocytic leukemia. Exp Hematol. 2002 Nov;30(11):1273-82. | |||||
| REF 100 | Pharmacogenetically driven patient selection for a first-in-human phase I trial of batracylin in patients with advanced solid tumors and lymphomas.Cancer Chemother Pharmacol.2013 Oct;72(4):917-23. | |||||
| REF 101 | Clinical pipeline report, company report or official report of GlaxoSmithKline (2009). | |||||
| REF 102 | Ex vivo characterization of XR11576 (MLN576) against ovarian cancer and other solid tumors. Anticancer Drugs. 2004 Oct;15(9):849-60. | |||||
| REF 103 | NK314, a topoisomerase II inhibitor that specifically targets the alpha isoform. J Biol Chem. 2008 Aug 29;283(35):23711-20. | |||||
| REF 104 | Ex vivo effects of the dual topoisomerase inhibitor tafluposide (F 11782) on cells isolated from fresh tumor samples taken from patients with cancer. Anticancer Drugs. 2003 Jul;14(6):467-73. | |||||
| REF 105 | Mechanism of action of the dual topoisomerase-I and -II inhibitor TAS-103 and activity against (multi)drug resistant cells. Cancer Chemother Pharmacol. 2000;45(1):78-84. | |||||
| REF 106 | Correlation of cytotoxicity and protein-associated DNA strand breaks for 2-(arylmethylamino)-1,3-propanediols. Anticancer Drug Des. 1998 Oct;13(7):825-35. | |||||
| REF 107 | Solution structure and dynamics of a complex between DNA and the antitumor bisnaphthalimide LU-79553: intercalated ring flipping on the millisecond time scale. Biochemistry. 1999 Nov 16;38(46):15104-15. | |||||
| REF 108 | GL331, a topoisomerase II inhibitor, induces radiosensitization of human glioma cells. Anticancer Res. 2006 May-Jun;26(3A):2149-56. | |||||
| REF 109 | Induction of apoptosis and cell cycle arrest in glioma cells by GL331 (a topoisomerase II inhibitor). Anticancer Res. 2005 Nov-Dec;25(6B):4203-8. | |||||
| REF 110 | KW-2170 (Kyowa Hakko Kogyo). IDrugs. 2002 Oct;5(10):1000-3. | |||||
| REF 111 | A structure-based 3D-QSAR study of anthrapyrazole analogues of the anticancer agents losoxantrone and piroxantrone. J Chem Inf Model. 2006 Jul-Aug;46(4):1827-35. | |||||
| REF 112 | The DNA topoisomerase II catalytic inhibitor merbarone is genotoxic and induces endoreduplication. Mutat Res. 2012 Oct-Nov;738-739:45-51. | |||||
| REF 113 | Effect of mitonafide analogs on topoisomerase II of Leishmania chagasi. Antimicrob Agents Chemother. 1996 Mar;40(3):706-9. | |||||
| REF 114 | The topoisomerase II-inhibitor NC-190 reduces the level of thymidine kinase mRNA in murine tumor cells. Res Commun Mol Pathol Pharmacol. 2002;111(1-4):77-87. | |||||
| REF 115 | A novel antitumor compound, NC-190, induces topoisomerase II-dependent DNA cleavage and DNA fragmentation. Cancer Chemother Pharmacol. 1996;38(1):29-34. | |||||
| REF 116 | Topoisomerase II inhibition and cytotoxicity of the anthrapyrazoles DuP 937 and DuP 941 (Losoxantrone) in the National Cancer Institute preclinical... J Natl Cancer Inst. 1994 Aug 17;86(16):1239-44. | |||||
| REF 117 | DNA topoisomerase II as the target for the anticancer drug TOP-53: mechanistic basis for drug action. Biochemistry. 2001 Jan 23;40(3):712-8. | |||||
| REF 118 | The interaction of nemorubicin metabolite PNU-159682 with DNA fragments d(CGTACG)(2), d(CGATCG)(2) and d(CGCGCG)(2) shows a strong but reversible binding to G:C base pairs. Bioorg Med Chem. 2012 Dec 15;20(24):6979-88. | |||||
| REF 119 | Design of new topoisomerase II inhibitors based upon a quinobenzoxazine self-assembly model. J Med Chem. 1998 Oct 22;41(22):4273-8. | |||||
| REF 120 | Use of catalytic topoisomerase II inhibitors to probe mechanisms of chemical-induced clastogenicity in Chinese hamster V79 cells. Environ Mol Mutagen. 2000;35(1):13-21. | |||||
| REF 121 | A new topoisomerase II inhibitor, BE-22179, produced by a streptomycete. I. Producing strain, fermentation, isolation and biological activity. J Antibiot (Tokyo). 1994 Feb;47(2):129-35. | |||||
| REF 122 | Toxicity of the antitumoral drug datelliptium in hepatic cells: Use of models in vitro for the prediction of toxicity in vivo. Toxicol In Vitro. 1992 Jul;6(4):295-302. | |||||
| REF 123 | Antitumor activity of ER-37328, a novel carbazole topoisomerase II inhibitor. Mol Cancer Ther. 2002 Jan;1(3):169-75. | |||||
| REF 124 | The inhibition and selectivity of bacterial topoisomerases by BMS-284756 and its analogues. J Antimicrob Chemother. 2001 Aug;48(2):195-201. | |||||
| REF 125 | Synthesis and pharmacological evaluation of new methyloxiranylmethoxyxanthone analogues. Eur J Med Chem. 2010 Sep;45(9):4221-8. | |||||
| REF 126 | Design, synthesis and biological evaluation of a novel series of anthrapyrazoles linked with netropsin-like oligopyrrole carboxamides as anticancer... Bioorg Med Chem. 2010 Jun 1;18(11):3974-84. | |||||
| REF 127 | Synthesis, topoisomerase I and II inhibitory activity, cytotoxicity, and structure-activity relationship study of hydroxylated 2,4-diphenyl-6-aryl ... Bioorg Med Chem. 2010 May 1;18(9):3066-77. | |||||
| REF 128 | Antitumor agents, 107. New cytotoxic 4-alkylamino analogues of 4'-demethyl-epipodophyllotoxin as inhibitors of human DNA topoisomerase II. J Nat Prod. 1989 May-Jun;52(3):606-13. | |||||
| REF 129 | 2,6-Dithienyl-4-furyl pyridines: Synthesis, topoisomerase I and II inhibition, cytotoxicity, structure-activity relationship, and docking study. Bioorg Med Chem Lett. 2010 Jan 1;20(1):42-7. | |||||
| REF 130 | Interactions of antitumor agents Ametantrone and Mitoxantrone (Novatrone) with double-stranded DNA. Biochem Pharmacol. 1985 Dec 15;34(24):4203-13. | |||||
| REF 131 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
| REF 132 | The high-resolution crystal structure of a 24-kDa gyrase B fragment from E.coli complexed with one of the most potent coumarin inhibitors, clorobiocin. Proteins. 1997 May;28(1):41-52. | |||||
| REF 133 | Catalytic inhibition of topoisomerase IIalpha by demethylzeylasterone, a 6-oxophenolic triterpenoid from Kokoona zeylanica. J Nat Prod. 2001 Oct;64(10):1294-6. | |||||
| REF 134 | The ChEMBL database in 2017. Nucleic Acids Res. 2017 Jan 4;45(D1):D945-D954. | |||||
| REF 135 | In vitro sensitivity of Trichomonas vaginalis to DNA topoisomerase II inhibitors. Southeast Asian J Trop Med Public Health. 2000 Mar;31(1):118-22. | |||||
| REF 136 | Anticancer effect of Howiinol A and its mechanism of action. J Asian Nat Prod Res. 1999;2(1):1-19. | |||||
| REF 137 | Screening of triterpenoids isolated from Phyllanthus flexuosus for DNA topoisomerase inhibitory activity. J Nat Prod. 2001 Dec;64(12):1545-7. | |||||
| REF 138 | Makaluvamine N: a new pyrroloiminoquinone from Zyzzya fuliginosa. J Nat Prod. 1997 Apr;60(4):408-10. | |||||
| REF 139 | Isoaurostatin, a novel topoisomerase inhibitor produced by Thermomonospora alba. J Nat Prod. 2001 Feb;64(2):204-7. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.