Target Information

Target General Infomation
Target ID
T58992
Former ID
TTDS00128
Target Name
Delta-type opioid receptor
Gene Name
OPRD1
Synonyms
DOR-1; Delta opioid receptor; OPRD1
Target Type
Successful
Disease Acute migraine [ICD9: 346; ICD10: G43]
Acute nonspecific diarrhea; Chronic diarrhea associated with inflammatory bowel disease [ICD10: K50, K60]
Alcohol use disorders [ICD9: 303; ICD10: F10.2]
Anxiety disorder [ICD9: 300, 311; ICD10: F32, F40-F42]
Bladder disease [ICD10: N30-N32]
Cough [ICD9: 786.2; ICD10: R05]
Diarrhea-predominant IBS [ICD9: 564.1; ICD10: K58.0]
Ischemic heart diseases [ICD9: 410-414; ICD10: I20-I25]
Moderate-to-severe pain [ICD10: R52, G89]
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32]
Overactive bladder disorder [ICD9: 188, 596.51; ICD10: C67, N32.81]
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89]
Premature ejaculation [ICD9: 302.75; ICD10: F52.4]
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
Substance dependence [ICD10: F10-F19]
Urinary incontinence [ICD9: 788.3; ICD10: N39.3, N39.4, R32]
Function
G-protein coupled receptor that functions as receptor for endogenous enkephalins and for a subset of other opioids. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain and in opiate-mediated analgesia. Plays a role in developing analgesic tolerance to morphine.
BioChemical Class
GPCR rhodopsin
Target Validation
T58992
UniProt ID
P41143
Sequence
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
Drugs and Mode of Action
Drug(s) Butorphanol Drug Info Approved Pain [538290], [542581]
Codeine Drug Info Approved Pain [538268], [539036]
Eluxadoline Drug Info Approved Diarrhea-predominant IBS [542668], [549001]
Hydromorphone Drug Info Approved Moderate-to-severe pain [551871]
Loperamide Drug Info Approved Acute nonspecific diarrhea; Chronic diarrhea associated with inflammatory bowel disease [551871]
Oxycodone Drug Info Approved Pain [538359], [542099]
ADL-5747 Drug Info Phase 2 Pain [522936]
ADL-5859 Drug Info Phase 2 Rheumatoid arthritis [522241]
AZD-2327 Drug Info Phase 2 Anxiety disorder [522445]
Carfentanil Drug Info Phase 2 Discovery agent [524366]
Met-enkephalin Drug Info Phase 2 Pain [521637], [538991]
TPM-1/Morphine Drug Info Phase 2 Pain [548201]
Codeine Drug Info Phase 1 Cough [533409], [539036]
MCP-201 Drug Info Phase 1 Pain [547634]
MCP-202 Drug Info Phase 1 Overactive bladder disorder [547635]
BIO-306 Drug Info Preclinical Acute migraine [536497]
SoRI-9409 Drug Info Preclinical Alcohol use disorders [548793]
DPI-3290 Drug Info Discontinued in Phase 2 Pain [546854]
DYNORPHIN A Drug Info Discontinued in Phase 2 Discovery agent [538995], [546012]
TRK-851 Drug Info Discontinued in Phase 1 Cough [547332]
VP004 Drug Info Discontinued in Phase 1 Substance dependence [548458]
BIPHALIN Drug Info Terminated Discovery agent [546535]
BW 373U86 Drug Info Terminated Discovery agent [545029]
LY-255582 Drug Info Terminated Discovery agent [545880]
SB-213698 Drug Info Terminated Discovery agent [546084]
SB-219825 Drug Info Terminated Pain [546476]
SNF-9007 Drug Info Terminated Discovery agent [546204]
Inhibitor (-)-cyclorphan Drug Info [527951]
(-)-eseroline Drug Info [551355]
(-)-isoelaeocarpiline Drug Info [528442]
(H-Dmt-Tic-Glu-NH-(CH(2))(5)-CO-Dap(6DMN)-NH(2) Drug Info [528238]
1,10-bis-(Dmt-Tic-amino)decane Drug Info [527916]
1,4-bis-(Dmt-Tic-amino)butane Drug Info [527916]
1,6-bis-(Dmt-Tic-amino)hexane Drug Info [527916]
1,6-bis-(N,N-dimethyl-Dmt-Tic-NH)hexane Drug Info [527916]
1-(1,2-diphenylethyl)-4-phenylpiperidin-4-ol Drug Info [528785]
1-(2-ethoxy-1-phenylethyl)-4-phenylpiperidin-4-ol Drug Info [528785]
1-(dio-tolylmethyl)-4-phenylpiperidin-4-ol Drug Info [528785]
1-benzhydryl-4-(2-fluorophenyl)piperidin-4-ol Drug Info [528781]
1-benzhydryl-4-(2-methoxyphenyl)piperidin-4-ol Drug Info [528781]
1-benzhydryl-4-(3-fluorophenyl)piperidin-4-ol Drug Info [528781]
1-benzhydryl-4-(3-methoxyphenyl)piperidin-4-ol Drug Info [528781]
1-benzhydryl-4-(3-phenylpropyl)piperidin-4-ol Drug Info [528781]
1-benzhydryl-4-(4-bromophenyl)piperidin-4-ol Drug Info [528781]
1-benzhydryl-4-(4-chlorophenyl)piperidin-4-ol Drug Info [528781]
1-benzhydryl-4-(4-fluorophenyl)piperidin-4-ol Drug Info [528781]
1-benzhydryl-4-(4-methoxyphenyl)piperidin-4-ol Drug Info [528781]
1-benzhydryl-4-(benzyloxy)-4-phenylpiperidine Drug Info [528785]
1-benzhydryl-4-(furan-2-yl)piperidin-4-ol Drug Info [528781]
1-benzhydryl-4-(thiophen-2-yl)piperidin-4-ol Drug Info [528781]
1-benzhydryl-4-benzylpiperidin-4-ol Drug Info [528781]
1-benzhydryl-4-butylpiperidin-4-ol Drug Info [528781]
1-benzhydryl-4-cyclohexylpiperidin-4-ol Drug Info [528781]
1-benzhydryl-4-ethoxy-4-phenylpiperidine Drug Info [528785]
1-benzhydryl-4-hexylpiperidin-4-ol Drug Info [528781]
1-benzhydryl-4-m-tolylpiperidin-4-ol Drug Info [528781]
1-benzhydryl-4-methoxy-4-phenylpiperidine Drug Info [528785]
1-benzhydryl-4-o-tolylpiperidin-4-ol Drug Info [528781]
1-benzhydryl-4-p-tolylpiperidin-4-ol Drug Info [528781]
1-benzhydryl-4-phenyl-4-propoxypiperidine Drug Info [528785]
1-benzhydryl-4-phenylpiperidin-4-ol Drug Info [530052]
1-[3-(3-biphenyl)-(1,2,4-triazol-4-yl) ]-3-phenol Drug Info [528288]
1-[3-(4-biphenyl)-(1,2,4-triazol-4-yl) ]-3-phenol Drug Info [528288]
14-O-phenylpropylnaltrexone Drug Info [529991]
17-(Cyclobutylmethyl)-N-phenylmorphinan-3-amine Drug Info [530529]
17-(Cyclopropylmethyl)-N-phenylmorphinan-3-amine Drug Info [530529]
17-methyl-4'-methyldihydromorphinone Drug Info [528375]
17-Methylmorphinan-3-yl 4-Iodophenyl Carbamate Drug Info [530529]
2-Hydroxymethyl-3-hydroxymorphinan Drug Info [530529]
3,6-bis(Dmt-Tic-NH-butyl)-2(1H)-pyrazinone Drug Info [527916]
3,6-bis(Dmt-Tic-NH-ethyl)-2(1H)-pyrazinone Drug Info [527916]
3,6-bis(Dmt-Tic-NH-methyl)-2(1H)-pyrazinone Drug Info [527916]
3,6-bis(Dmt-Tic-NH-propyl)-2(1H)-pyrazinone Drug Info [527916]
3-desoxy-3-carboxamidonaltrexone Drug Info [530013]
4-(4-((phenethylamino)methyl)phenoxy)benzamide Drug Info [528996]
4-(p-Tolyl)spiro[chromene-2,4'-piperidine] Drug Info [529689]
4-(Spiro[chromene-2,4'-piperidine]-4-yl)benzamide Drug Info [530324]
4-(Spiro[chromene-2,4'-piperidine]-4-yl)phenol Drug Info [529689]
4-phenyl-1-(1-phenylbutyl)piperidin-4-ol Drug Info [528785]
4-phenyl-1-(1-phenylheptyl)piperidin-4-ol Drug Info [528785]
4-phenyl-1-(1-phenylhexyl)piperidin-4-ol Drug Info [528785]
4-phenyl-1-(1-phenylpentyl)piperidin-4-ol Drug Info [528785]
4-phenyl-1-(phenyl(m-tolyl)methyl)piperidin-4-ol Drug Info [528785]
4-phenyl-1-(phenyl(o-tolyl)methyl)piperidin-4-ol Drug Info [528785]
4-phenyl-1-(phenyl(p-tolyl)methyl)piperidin-4-ol Drug Info [528785]
4-phenyl-4-[1H-imidazol-2-yl]-piperidine Drug Info [527810]
4-Phenylspiro[chromene-2,4'-piperidine] Drug Info [529689]
5-(4-((phenethylamino)methyl)phenoxy)picolinamide Drug Info [528996]
6-(2-phenethylisoindolin-5-yloxy)nicotinamide Drug Info [529132]
6-(4-((benzylamino)methyl)phenoxy)nicotinamide Drug Info [528996]
6-(4-((phenethylamino)methyl)phenoxy)nicotinamide Drug Info [529132]
6-(4-(2-(benzylamino)ethyl)phenoxy)nicotinamide Drug Info [529132]
6-(4-(3-(benzylamino)propyl)phenoxy)nicotinamide Drug Info [528996]
6-(Allyl-methyl-amino)-4,4-diphenyl-heptan-3-ol Drug Info [533539]
6-cinnamoyl-N-methylstephasunoline Drug Info [530876]
6-cinnamoylhernandine Drug Info [530876]
6-desoxonaltrexone Drug Info [530013]
6beta-naltrexol HCl Drug Info [530077]
8-azabicyclo[3.2.1]octan-3-yloxy-benzamide Drug Info [531109]
8-carboxamidocyclazocine Drug Info [529429]
AKNADILACTAM Drug Info [530876]
AMINOFENTANYL Drug Info [528300]
ANALOG OF DYNORPHIN A Drug Info [533889]
Antanal 1 Drug Info [529704]
Antanal 2 Drug Info [529704]
Benzyl derivative of M6G Drug Info [527461]
BIPHALIN Drug Info [530392]
Bis-((-)-N-propargylmorphinan-3-yl) sebacoylate Drug Info [527951]
BUTORPHAN Drug Info [530707]
CARBOXYFENTANYL Drug Info [529088]
CCDC 710249, HCl salt Drug Info [530013]
Cis-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH Drug Info [528875]
Clocinnamox Drug Info [529991]
CYCLAZOCINE Drug Info [529871]
CYCLORPHAN Drug Info [530529]
C[L-mTyr-D-pro-L-Phe-D-trp] Drug Info [530160]
C[L-Phe-D-pro-L-mTyr-D-trp] Drug Info [530160]
C[L-Phe-D-pro-L-Phe-L-trp] Drug Info [530160]
D-Phe-Cys-Tyr-D-Trp-Arg-Thr-Pen-Thr-NH2(CTAP) Drug Info [533376]
D-Phe-Cys-Tyr-D-Trp-Lys-Thr-Pen-Thr-NH2(CTP) Drug Info [533376]
D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2(CTOP) Drug Info [533376]
D-PhGly-Cys-Tyr-D-Trp-Lys-Thr-Pen-Thr-NH2 Drug Info [533376]
DAMGO Drug Info [551220]
Dcp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 Drug Info [528376]
Delta-kappa opioid heterodimer Drug Info [527089]
DELTORPHIN Drug Info [533972]
DELTORPHIN-II Drug Info [531038]
Deprotected cogener of M6G Drug Info [527461]
DERMORPHIN Drug Info [527931]
Dhp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 Drug Info [528376]
Dimepheptanol Drug Info [533539]
Dmt-Pro-3,5Dmp-Phe-NH2 Drug Info [528832]
Dmt-Pro-Dmp-Phe-NH2 Drug Info [528832]
Dmt-Pro-Dmt-Phe-NH2 Drug Info [528832]
Dmt-Pro-Emp-Phe-NH2 Drug Info [528832]
Dmt-Pro-Imp-Phe-NH2 Drug Info [528832]
Dmt-Pro-Mmp-Phe-NH2 Drug Info [528832]
Dmt-Pro-Phe-D-1-Nal-NH2 Drug Info [528646]
Dmt-Pro-Phe-D-2-Nal-NH2 Drug Info [528646]
Dmt-Pro-Phe-Phe-NH2 Drug Info [528832]
Dmt-Pro-Tmp-Phe-NH2 Drug Info [528832]
Dmt-Pro-Trp-D-2-Nal-NH2 Drug Info [528646]
DPDPE Drug Info [551220]
DYNORPHIN A Drug Info [533889]
ELAEOCARPENINE Drug Info [530705]
ENDOMORPHIN 2 Drug Info [531092]
ENDOMORPHIN-1 Drug Info [529556]
ETONITAZENE Drug Info [531519]
FALCARINDIOL Drug Info [529238]
Grandisine C Drug Info [528442]
Grandisine D Drug Info [528442]
Grandisine F Drug Info [528442]
GUANIDINONALTRINDOLE Drug Info [526656]
H-2',6'-dimethyltyrosine-Tic-OH Drug Info [530447]
H-2',6'-dimethyltyrosine-Tic-Phe-Phe-OH Drug Info [530447]
H-Aba-ala-Gly-Phe-leu-OH Drug Info [528724]
H-Aba-ala-Gly-Phe-Met-OH Drug Info [528724]
H-Aba-Gly-Gly-Phe-Leu-OH Drug Info [528724]
H-Aba-ser-Gly-Phe-Leu-Thr-OH Drug Info [528724]
H-Apa-ala-Gly-Phe-leu-OH Drug Info [528724]
H-Cdp-ala-Gly-Phe-leu-OH Drug Info [528724]
H-Cdp-Gly-Gly-Phe-Leu-OH Drug Info [528724]
H-Cdp-ser-Gly-Phe-Leu-Thr-OH Drug Info [528724]
H-Cpa-c[pen-Gly-Phe-pen]OH Drug Info [528724]
H-Cpa-Gly-Gly-Phe-Met-NH2 Drug Info [528724]
H-Cpa-Gly-Gly-Phe-Met-OH Drug Info [528724]
H-Cxp-ala-Gly-Phe-leu-OH Drug Info [528724]
H-D-Phe-c[Cys-Tyr-DTrp-Orn-Thr-Pen]-Thr-NH2 Drug Info [529704]
H-D-Tca-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 Drug Info [525699]
H-D-Tic-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 Drug Info [525699]
H-D-Trp-c[Cys-Tyr-D-Trp-Arg-Thr-Pen]-Thr-NH2 Drug Info [525699]
H-Dmt-Aba-Gly-NH-CH2-Bid Drug Info [528269]
H-Dmt-Aba-Gly-NH-CH2-Ph Drug Info [528269]
H-Dmt-Aba-Gly-NH-Ph Drug Info [528269]
H-Dmt-D-Arg(NO2)-Phe-Lys(Z)-NH2 Drug Info [527693]
H-Dmt-D-Arg(NO2)-Phe-Lys(Z)-OH Drug Info [527693]
H-Dmt-Tic-(2R,3R)-beta-MeCha-Phe-NH2 Drug Info [528621]
H-Dmt-Tic-(2R,3R)-beta-MeCha-Phe-OH Drug Info [528621]
H-Dmt-Tic-(2R,3S)-beta-MeCha-Phe-NH2 Drug Info [528621]
H-Dmt-Tic-(2R,3S)-beta-MeCha-Phe-OH Drug Info [528621]
H-Dmt-Tic-(2S,3R)-beta-MeCha-Phe-NH2 Drug Info [528621]
H-Dmt-Tic-(2S,3R)-beta-MeCha-Phe-OH Drug Info [528621]
H-Dmt-Tic-(2S,3S)-beta-MeCha-Phe-NH2 Drug Info [528621]
H-Dmt-Tic-(2S,3S)-beta-MeCha-Phe-OH Drug Info [528621]
H-Dmt-Tic-Asp-N(Me)-Ph Drug Info [529630]
H-Dmt-Tic-Asp-NH-Bzl Drug Info [529630]
H-Dmt-Tic-Asp-NH-Ph Drug Info [529630]
H-Dmt-Tic-D-Asp-N(Me)-Ph Drug Info [529630]
H-Dmt-Tic-D-Asp-NH-Ph Drug Info [529630]
H-Dmt-Tic-Glu-Dap(6DMN)-NH(2) Drug Info [528238]
H-Dmt-Tic-Glu-NH-(CH2)5-NH2 Drug Info [527332]
H-Dmt-Tic-Glu-NH2 Drug Info [527332]
H-Dmt-Tic-Gly-N(Me)-Ph Drug Info [529630]
H-Dmt-Tic-Gly-NH-Bzl Drug Info [529630]
H-Dmt-Tic-Gly-NH-CH2-Bid Drug Info [528269]
H-Dmt-Tic-Gly-NH-Ph Drug Info [529630]
H-Dmt-Tic-Lys(Ac)-NH-CH2-Ph Drug Info [528411]
H-Dmt-Tic-Lys(Ac)-NH-Ph Drug Info [528411]
H-Dmt-Tic-Lys(Z)-NH-CH2-Ph Drug Info [528411]
H-Dmt-Tic-Lys(Z)-NH-Ph Drug Info [528411]
H-Dmt-Tic-Lys-NH-CH2-Ph Drug Info [528411]
H-Dmt-Tic-Lys-NH-Ph Drug Info [528411]
H-Dmt-Tic-NH-(CH2)6-NH-Dmt-H Drug Info [527758]
H-Dmt-Tic-NH-(CH2)6-NH-Phe-H Drug Info [527758]
H-Dmt-Tic-NH-(CH2)6-NH-Tic-H Drug Info [527758]
H-Dmt-Tic-NH-(D)-CH[(CH2)4-NH-Z]-Bid Drug Info [528411]
H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid Drug Info [529630]
H-Dmt-Tic-NH-(R)CH(CH2-COOH)-Bid(N1-Me) Drug Info [529630]
H-Dmt-Tic-NH-(S)CH(CH2-COOH)-Bid(N1-Me) Drug Info [529630]
H-Dmt-Tic-NH-CH2-Boa Drug Info [529246]
H-Dmt-Tic-NH-CH2-Bta Drug Info [529246]
H-Dmt-Tic-NH-CH2-CH2-NH2 Drug Info [529041]
H-Dmt-Tic-NH-CH2-Imid Drug Info [529246]
H-Dmt-Tic-NH-CH2-ImidPh Drug Info [529246]
H-Dmt-Tic-NH-CH2-Indl Drug Info [529246]
H-Dmt-Tic-NH-CH2-Indn Drug Info [529246]
H-Dmt-Tic-NH-CH[(CH2)4-NH-Ac]-Bid Drug Info [528411]
H-Dmt-Tic-NH-CH[(CH2)4-NH-Z]-Bid Drug Info [528411]
H-Dmt-Tic-NH-CH[(CH2)4-NH2]-Bid Drug Info [528411]
H-Dmt-Tic-OH Drug Info [527916]
H-mCpa-ala-Gly-Phe-leu-OH Drug Info [528724]
H-mCpa-Gly-Gly-Phe-Leu-OH Drug Info [528724]
H-mCpa-ser-Gly-Phe-Leu-Thr-OH Drug Info [528724]
H-Poa-ser-Gly-Phe-Leu-Thr-OH Drug Info [528724]
H-Tyr-c[cys-Gly-Phe(p-NO2)-cys]NH2 Drug Info [528724]
H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]-OH Drug Info [528875]
H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]NH2 Drug Info [528692]
H-Tyr-c[D-Allylgly-Gly-Phe-L-Allylgly]NH2 Drug Info [528692]
H-Tyr-c[D-Cys-Gly-Phe-D-Cys]NH2 Drug Info [528692]
H-Tyr-c[D-Cys-Gly-Phe-L-Cys]NH2 Drug Info [528692]
H-Tyr-c[D-Orn-(D or L)Atc-Glu]-NH2 Drug Info [528093]
H-Tyr-c[D-Orn-Aic-Glu]-NH2 Drug Info [528093]
H-Tyr-c[pen-Gly-Phe-pen]OH Drug Info [528724]
H-Tyr-D-Ala-Gly Phe-Pro-Leu-Trp-O-3,5-Bzl(CF3)2 Drug Info [529306]
H-Tyr-D-Ala-Gly-Phe-D-Leu Drug Info [528853]
H-Tyr-D-Ala-Gly-Phe-NH-NH-(NMe)Phe-Asp-Nle-Trp-Ac Drug Info [528058]
H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Phe-D-Asp-D-Nle-Trp-H Drug Info [528606]
H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Trp-Nle-Asp-Phe-Bo Drug Info [528606]
H-Tyr-D-Ala-Gly-Phe-NH-NH-D-Trp-Nle-Asp-Phe-H Drug Info [528606]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-D-Trp-Boc Drug Info [528058]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-D-Trp-H Drug Info [528058]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-Trp-Ac Drug Info [528058]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-Nle-Trp-Boc Drug Info [528058]
H-Tyr-D-Ala-Gly-Phe-NH-NH-Trp-D-Nle-D-Asp-D-Phe-H Drug Info [528606]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NH-3,5-Bzl(CF3)2 Drug Info [529306]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NH-Bzl Drug Info [529306]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NMe-3,5-Bzl(CF3)2 Drug Info [529306]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-NMe-Bzl Drug Info [529306]
H-Tyr-D-Ala-Gly-Phe-Pro-Leu-Trp-O-Bzl Drug Info [529306]
H-Tyr-Gly-Gly-Phe-Met-NH2 Drug Info [528724]
H-Tyr-Gly-Gly-Phe-Met-OH Drug Info [528724]
H-Tyr-NMe-D-Ala-Phe-Sar-NH2 Drug Info [529395]
H-Tyr-Pro-Dap(6DMN)-Phe-NH2 Drug Info [528238]
H-Tyr-Pro-Phe-Phe-NH-(CH2)5-(C=O)-Dap(6DMN)-NH2 Drug Info [528238]
H-Tyr-Pro-Phe-Phe-NH-CH2-CH2-NH Tic Dmt-H Drug Info [529041]
H-Tyr-Tic-Cha-Phe-OH Drug Info [528621]
H-Tyr-Tic-OH Drug Info [530447]
H-Tyr-Tic-Phe-Phe-OH Drug Info [528621]
HERKINORIN Drug Info [529401]
HTyr-Gly-Gly-Phe-Leu-Arg-Arg-lle-Arg-Pro-LysNH2 Drug Info [530428]
ICI-174864 Drug Info [528410]
ICI-199441 Drug Info [527541]
ISOELAEOCARPINE Drug Info [528801]
LOFENTANIL Drug Info [533543]
LONGANINE Drug Info [530876]
LOPHOCLADINE A Drug Info [528165]
LY-255582 Drug Info [534631]
M6G thiosaccharide analogue Drug Info [527461]
MC-CAM Drug Info [530461]
MCL-117 Drug Info [527951]
MCL-139 Drug Info [527951]
MCL-144 Drug Info [530279]
MCL-145 Drug Info [527951]
MCL-147 Drug Info [528787]
MCL-149 Drug Info [528787]
MCL-153 Drug Info [530707]
MCL-154 Drug Info [530707]
MCL-182 Drug Info [528787]
MCL-183 Drug Info [528787]
MCL-428 Drug Info [528655]
MCL-429 Drug Info [528655]
MCL-431 Drug Info [528655]
MCL-432 Drug Info [528655]
MCL-433 Drug Info [528655]
MCL-434 Drug Info [528655]
MCL-435 Drug Info [528655]
MCL-443 Drug Info [528655]
MCL-444 Drug Info [528655]
MCL-445 Drug Info [528787]
MCL-446 Drug Info [528787]
MCL-447 Drug Info [528787]
MCL-448 Drug Info [528787]
MCL-449 Drug Info [528655]
MCL-450 Drug Info [528412]
MCL-451 Drug Info [528412]
MCL-458 Drug Info [528787]
METAZOCINE Drug Info [529816]
N-(17-Methylmorphinan-3-yl)-N'-phenylurea Drug Info [530529]
N-(4-Iodophenyl)-N'-(17-methylmorphinan-3-yl)urea Drug Info [530529]
N-alpha-amidino-Tyr(Me)-Pro-Trp-p-Cl-Phe-NH2 Drug Info [528594]
N-alpha-amidino-Tyr(Me)-Pro-Trp-Phe-NH2 Drug Info [528594]
N-Benzyl-17-(cyclobutylmethyl)morphinan-3-amine Drug Info [530529]
N-Benzyl-17-(cyclopropylmethyl)morphinan-3-amine Drug Info [530529]
N-methylstephisoferulin Drug Info [530876]
N-methylstephuline Drug Info [530876]
Naltrexone-6-alpha-ol Drug Info [529816]
Naltrexone-6-beta-ol Drug Info [529816]
NORBINALTORPHIMINE Drug Info [526656]
O-DESMETHYL TRAMADOL Drug Info [529816]
OXYMORPHINDOLE Drug Info [529414]
PERIPENTADENINE Drug Info [529173]
PHENAZOCINE Drug Info [529816]
PROSTEPHABYSSINE Drug Info [530876]
RTI-5989-23 Drug Info [534631]
RTI-5989-25 Drug Info [534631]
RTI-5989-31 Drug Info [528947]
SALVINORIN A Drug Info [529401]
SB-0304 Drug Info [529395]
SB-213698 Drug Info [530073]
SN-11 Drug Info [530073]
SN-23 Drug Info [530073]
SN-28 Drug Info [531165]
SNF-9007 Drug Info [528193]
SOMATOSTATIN Drug Info [533376]
TPM-1/Morphine Drug Info [544320]
Trans-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH Drug Info [528875]
Tyr-(NMe)Ala-L-Phe-D-Pro-NH2 Drug Info [534004]
Tyr-(R)-Aba-Gly-Phe-NH2 Drug Info [529202]
Tyr-(S)-Aba-Gly-Phe-NH2 Drug Info [529202]
Tyr-(S)-spiro-Aba-Gly-Phe-NH2 Drug Info [529202]
Tyr-D-Ala-Gly-D-Trp-Nle-Asp-Phe-NH2 Drug Info [528193]
Tyr-D-Ala-Gly-D-Trp-NMeNle-Asp-Phe-NH2 Drug Info [528193]
Tyr-D-Ala-Gly-Phe-Met-NH2 Drug Info [530392]
Tyr-D-Ala-Gly-Phe-Met-Pro-Leu-Trp-NH-Bzl Drug Info [529724]
Tyr-D-Ala-Gly-Phe-NH-NH-Phe-Asp-NMeNle-D-Trp-Boc Drug Info [528058]
Tyr-D-Ala-Gly-Trp-Nle-Asp-Phe-NH2 Drug Info [528193]
Tyr-D-Ala-Gly-Trp-NMeNle-Asp-Phe-NH2 Drug Info [528193]
Tyr-D-Ala-Phe-Asp-Val-Val-Thr[Beta-D-Glc]-Gly-NH2 Drug Info [534460]
Tyr-D-Ala-Phe-Glu-Val-Val-Gly-NH2 Drug Info [533971]
Tyr-D-Ala-Phe-Gly-Tyr-Pro-Thr(Beta-D-Glc)-Gly-NH2 Drug Info [534460]
Tyr-D-Ala-Phe-Thr(-D-Glc)-Tyr-Pro-Ser-NH2 Drug Info [534460]
Tyr-D-Met-Phe-His-Leu-Met-Asp-NH2 Drug Info [533971]
Tyr-D-Nle-Gly-D-Trp-Nle-Asp-Phe-NH2 Drug Info [528193]
Tyr-D-Nle-Gly-D-Trp-NMeNle-Asp-Phe-NH2 Drug Info [528193]
Tyr-D-Nle-Gly-Trp-Nle-Asp-Phe-NH2 Drug Info [528193]
Tyr-D-Nle-Gly-Trp-NMeNle-Asp-Phe-NH2 Drug Info [528193]
Tyr-D-Phe-Gly-D-Trp-Nle-Asp-Phe-NH2 Drug Info [528193]
Tyr-D-Phe-Gly-D-Trp-NMeNle-Asp-Phe-NH2 Drug Info [528193]
Tyr-D-Phe-Gly-Trp-Nle-Asp-Phe-NH2 Drug Info [528193]
Tyr-D-Phe-Gly-Trp-NMeNle-Asp-Phe-NH2 Drug Info [528193]
Tyr-D-Pro-Gly-Trp-NMeNle-Asp-Phe-NH2 Drug Info [528193]
Tyr-Gly-Gly-Phe-c(Cys-Arg-Arg-Ile-Cys)-Arg-lys Drug Info [533889]
Tyr-Gly-Gly-Phe-leu-c(Cys-Arg-Ile-Arg-Cys)-lys Drug Info [533889]
Tyr-Gly-Gly-Trp-NMeNle-Asp-Phe-NH2 Drug Info [528193]
Tyr-Pro-3,5Dmp-Phe-NH2 Drug Info [528832]
Tyr-Pro-D-Phe-D-Pro-NH2 Drug Info [534004]
Tyr-Pro-D-Phe-Pro-NH2 Drug Info [534004]
Tyr-Pro-D-Phg-Phe-NH2 Drug Info [528190]
Tyr-Pro-Dmp-Phe-NH2 Drug Info [528832]
Tyr-Pro-Dmt-Phe-NH2 Drug Info [528832]
Tyr-Pro-Emp-Phe-NH2 Drug Info [528832]
Tyr-Pro-Gly-Trp-NMeNle-Asp-Phe-NH2 Drug Info [528193]
Tyr-Pro-Imp-Phe-NH2 Drug Info [528832]
Tyr-Pro-L-(NMe)Phe-D-Pro-NH2 Drug Info [534004]
Tyr-Pro-L-(NMe)Phe-Pro-NH2 Drug Info [534004]
Tyr-Pro-L-Phe-D-Pro-NH2 Drug Info [534004]
Tyr-Pro-L-Phe-Pro-NH2 Drug Info [534004]
Tyr-Pro-Mmp-Phe-NH Drug Info [528832]
Tyr-Pro-Phe-Phe-N(CH3)2 Drug Info [529480]
Tyr-Pro-Phe-Phe-NHCH3 Drug Info [529480]
Tyr-Pro-Phe-Phe-NHNH2 Drug Info [529480]
Tyr-Pro-Phe-Phe-OC(CH3)3 Drug Info [529480]
Tyr-Pro-Phe-Phe-OCH2CH3 Drug Info [529480]
Tyr-Pro-Phe-Phe-OCH2OH Drug Info [529480]
Tyr-Pro-Phe-Phe-OCH3 Drug Info [529480]
Tyr-Pro-Tmp-Phe-NH Drug Info [528832]
UFP-502 Drug Info [531038]
UFP-512 Drug Info [531038]
[Dcp1]Dyn A(1-11)-NH2 Drug Info [528376]
[Leu5]enkephalin Drug Info [530780]
Agonist 3-Methylfentanyl Drug Info [551402]
3-Methylthiofentanyl Drug Info [551408]
ADL-5747 Drug Info [543762]
ADL-5859 Drug Info [543762]
ARD-412 Drug Info [543762]
AZD-2327 Drug Info [531414]
BBI-11008 Drug Info [543762]
Beta-endorphin Drug Info [537660]
BIO-306 Drug Info [536497]
Butorphanol Drug Info [536098]
BW 373U86 Drug Info [535207]
Carfentanil Drug Info [551406]
Codeine Drug Info [536098]
DADLE Drug Info [535092]
Dihydromorphine Drug Info [551379]
Dimethylthiambutene Drug Info [551393]
DPI-221 Drug Info [543762]
DPI-3290 Drug Info [525347]
DSLET Drug Info [543762]
DSTBULET Drug Info [533358]
dynorphin B Drug Info [543762]
ethyketazocine Drug Info [534018]
ethylketocyclazocine Drug Info [543762]
Etorphine Drug Info [535235]
Leu-enkephalin Drug Info [535152]
MCP-201 Drug Info [550920]
MCP-202 Drug Info [547636]
MCP-203 Drug Info [543762]
MCP-204 Drug Info [543762]
MCP-205 Drug Info [543762]
Met-enkephalin Drug Info [537870]
normorphine Drug Info [543762]
NRP290 Drug Info [543762]
Oxycodone Drug Info [536427]
SB 227122 Drug Info [534953]
SNC-80 Drug Info [534994], [535449]
Tonazocine mesylate Drug Info [534994]
[3H]diprenorphine Drug Info [543762]
Antagonist 7-benzylidenenaltrexone Drug Info [535501]
CTAP Drug Info [543762]
Diprenorphine Drug Info [551387]
ICI 154129 Drug Info [537722]
naltriben Drug Info [529508]
Naltrindole Drug Info [535501]
quadazocine Drug Info [543762]
SoRI-9409 Drug Info [526028]
TIP Drug Info [534987]
TIPP Drug Info [534987]
TIPPpsi Drug Info [533937]
TRK-851 Drug Info [529642], [551871]
[3H]naltriben Drug Info [534682]
[3H]naltrindole Drug Info [526730]
Modulator Eluxadoline Drug Info
SB-219825 Drug Info [526061]
Binder Hydromorphone Drug Info [535919]
Loperamide Drug Info [537797]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway cGMP-PKG signaling pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
PANTHER Pathway Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway
Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway
Enkephalin release
Opioid proenkephalin pathway
Opioid proopiomelanocortin pathway
Reactome Peptide ligand-binding receptors
G alpha (i) signalling events
WikiPathways GPCRs, Class A Rhodopsin-like
Peptide GPCRs
GPCR ligand binding
GPCR downstream signaling
References
Ref 521637ClinicalTrials.gov (NCT00109941) Opioid Growth Factor in Treating Patients With Advanced Pancreatic Cancer That Cannot Be Removed By Surgery. U.S. National Institutes of Health.
Ref 522241ClinicalTrials.gov (NCT00626275) Study Evaluating the Analgesic Efficacy and Safety of ADL5859 in Subjects With Rheumatoid Arthritis. U.S. National Institutes of Health.
Ref 522445ClinicalTrials.gov (NCT00759395) Study of Antidepressant Efficacy of a Selective, High Affinity Enkephalinergic Agonist in Anxious Major Depressive Disorder (AMDD). U.S. National Institutes of Health.
Ref 522936ClinicalTrials.gov (NCT01058642) Study to Assess the Efficacy, Safety, and Tolerability of ADL5747 in Patients With Postherpetic Neuralgia. U.S. National Institutes of Health.
Ref 524366ClinicalTrials.gov (NCT01899170) Towards Individualized Deep Brain Stimulation Treatment of Chronic Neuropathic Pain. U.S. National Institutes of Health.
Ref 533409Effects of a mu-opioid receptor agonist (codeine phosphate) on visuo-motor coordination and dynamic visual acuity in man. Br J Clin Pharmacol. 1986 Nov;22(5):507-12.
Ref 536497Pharmacologic therapeutics for cardiac reperfusion injury. Expert Opin Emerg Drugs. 2007 Sep;12(3):367-88.
Ref 538268FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074256.
Ref 538290FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 075046.
Ref 538359FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 085910.
Ref 538991(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1614).
Ref 538995(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1620).
Ref 539036(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1673).
Ref 542099(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7093).
Ref 542581(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7591).
Ref 542668(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7691).
Ref 545029Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001926)
Ref 545880Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005187)
Ref 546012Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005877)
Ref 546084Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006271)
Ref 546204Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006885)
Ref 546476Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008418)
Ref 546535Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008840)
Ref 546854Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010668)
Ref 547332Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015232)
Ref 547634Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018011)
Ref 547635Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018026)
Ref 548201Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023017)
Ref 548458Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025668)
Ref 548793Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028893)
Ref 549001Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031329)
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 525347DPI-3290 [(+)-3-((alpha-R)-alpha-((2S,5R)-4-Allyl-2,5-dimethyl-1-piperazinyl)-3-hydroxybenzyl)-N-(3-fluorophenyl)-N-methylbenzamide]. II. A mixed opioid agonist with potent antinociceptive activity and limited effects on respiratory function. J Pharmacol Exp Ther. 2003 Dec;307(3):1227-33. Epub 2003 Oct 8.
Ref 525699J Med Chem. 2000 Feb 24;43(4):569-80.Opiate aromatic pharmacophore structure-activity relationships in CTAP analogues determined by topographical bias, two-dimensional NMR, and biological activity assays.
Ref 526028In vivo pharmacological characterization of SoRI 9409, a nonpeptidic opioid mu-agonist/delta-antagonist that produces limited antinociceptive tolerance and attenuates morphine physical dependence. J Pharmacol Exp Ther. 2001 May;297(2):597-605.
Ref 526061Mutation W284L of the human delta opioid receptor reveals agonist specific receptor conformations for G protein activation. Life Sci. 2001 Apr 6;68(19-20):2233-42.
Ref 526656J Med Chem. 2003 Jul 3;46(14):3127-37.Identification of (3R)-7-hydroxy-N-((1S)-1-[[(3R,4R)-4-(3-hydroxyphenyl)- 3,4-dimethyl-1-piperidinyl]methyl]-2-methylpropyl)-1,2,3,4-tetrahydro- 3-isoquinolinecarboxamide as a novel potent and selective opioid kappa receptor antagonist.
Ref 526730Characterization of [3H]naltrindole binding to delta opioid receptors in rat brain. Life Sci. 1992;50(16):PL119-24.
Ref 527089J Med Chem. 2004 Jun 3;47(12):2969-72.A bivalent ligand (KDN-21) reveals spinal delta and kappa opioid receptors are organized as heterodimers that give rise to delta(1) and kappa(2) phenotypes. Selective targeting of delta-kappa heterodimers.
Ref 527332J Med Chem. 2004 Dec 16;47(26):6541-6.Highly selective fluorescent analogue of the potent delta-opioid receptor antagonist Dmt-Tic.
Ref 527461Bioorg Med Chem Lett. 2005 Mar 15;15(6):1583-6.Synthesis and in vitro biological evaluation of a carbon glycoside analogue of morphine-6-glucuronide.
Ref 527541Bioorg Med Chem Lett. 2005 May 16;15(10):2647-52.Arylacetamide kappa opioid receptor agonists with reduced cytochrome P450 2D6 inhibitory activity.
Ref 527693J Med Chem. 2005 Aug 25;48(17):5608-11.From the potent and selective mu opioid receptor agonist H-Dmt-d-Arg-Phe-Lys-NH(2) to the potent delta antagonist H-Dmt-Tic-Phe-Lys(Z)-OH.
Ref 527758Bioorg Med Chem Lett. 2005 Dec 15;15(24):5517-20. Epub 2005 Sep 23.New series of potent delta-opioid antagonists containing the H-Dmt-Tic-NH-hexyl-NH-R motif.
Ref 527810Bioorg Med Chem Lett. 2006 Jan 1;16(1):146-9. Epub 2005 Oct 19.4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives, a novel class of selective delta-opioid agonists.
Ref 527916J Med Chem. 2005 Dec 15;48(25):8035-44.Potent Dmt-Tic pharmacophoric delta- and mu-opioid receptor antagonists.
Ref 527931J Med Chem. 2005 Dec 29;48(26):8112-4.Conversion of the potent delta-opioid agonist H-Dmt-Tic-NH-CH(2)-bid into delta-opioid antagonists by N(1)-benzimidazole alkylation(1).
Ref 527951J Med Chem. 2006 Jan 12;49(1):256-62.Synthesis and preliminary in vitro investigation of bivalent ligands containing homo- and heterodimeric pharmacophores at mu, delta, and kappa opioid receptors.
Ref 528058J Med Chem. 2006 Mar 9;49(5):1773-80.Design and synthesis of novel hydrazide-linked bifunctional peptides as delta/mu opioid receptor agonists and CCK-1/CCK-2 receptor antagonists.
Ref 528093J Med Chem. 1991 Oct;34(10):3125-32.Conformational restriction of the phenylalanine residue in a cyclic opioid peptide analogue: effects on receptor selectivity and stereospecificity.
Ref 528165J Nat Prod. 2006 Apr;69(4):640-4.Lophocladines, bioactive alkaloids from the red alga Lophocladia sp.
Ref 528190Bioorg Med Chem Lett. 2006 Jul 15;16(14):3688-92. Epub 2006 May 8.Opioid receptor binding and antinociceptive activity of the analogues of endomorphin-2 and morphiceptin with phenylalanine mimics inthe position 3 or 4.
Ref 528193J Med Chem. 2006 May 18;49(10):2868-75.Structure-activity relationships of bifunctional peptides based on overlapping pharmacophores at opioid and cholecystokinin receptors.
Ref 528238J Med Chem. 2006 Jun 15;49(12):3653-8.6-N,N-dimethylamino-2,3-naphthalimide: a new environment-sensitive fluorescent probe in delta- and mu-selective opioid peptides.
Ref 528269J Med Chem. 2006 Jun 29;49(13):3990-3.New 2',6'-dimethyl-L-tyrosine (Dmt) opioid peptidomimetics based on the Aba-Gly scaffold. Development of unique mu-opioid receptor ligands.
Ref 528288J Med Chem. 2006 Jul 13;49(14):4044-7.Discovery of novel triazole-based opioid receptor antagonists.
Ref 528300Bioorg Med Chem Lett. 2006 Sep 15;16(18):4946-50. Epub 2006 Jul 7.Synthesis and evaluation of 3-aminopropionyl substituted fentanyl analogues for opioid activity.
Ref 528375J Med Chem. 2006 Aug 24;49(17):5333-8.Structural determinants of opioid activity in derivatives of 14-aminomorphinones: effect of substitution in the aromatic ring of cinnamoylaminomorphinones and codeinones.
Ref 528376J Med Chem. 2006 Aug 24;49(17):5382-5.Replacement of the N-terminal tyrosine residue in opioid peptides with 3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid (Dcp) results in novel opioid antagonists.
Ref 528410J Med Chem. 2006 Sep 7;49(18):5597-609.Highly potent and selective phenylmorphan-based inverse agonists of the opioid delta receptor.
Ref 528411J Med Chem. 2006 Sep 7;49(18):5610-7.Effect of lysine at C-terminus of the Dmt-Tic opioid pharmacophore.
Ref 528412J Med Chem. 2006 Sep 7;49(18):5640-3.New opioid designed multiple ligand from Dmt-Tic and morphinan pharmacophores.
Ref 528442J Nat Prod. 2006 Sep;69(9):1295-9.Grandisines C-G, indolizidine alkaloids from the Australian rainforest tree Elaeocarpus grandis.
Ref 528594Bioorg Med Chem. 2007 Feb 15;15(4):1694-702. Epub 2006 Dec 12.Endomorphin-1 analogs with enhanced metabolic stability and systemic analgesic activity: design, synthesis, and pharmacological characterization.
Ref 528606J Med Chem. 2007 Jan 11;50(1):165-8.Partial retro-inverso, retro, and inverso modifications of hydrazide linked bifunctional peptides for opioid and cholecystokinin (CCK) receptors.
Ref 528621J Med Chem. 2007 Jan 25;50(2):328-33.Beta-methyl substitution of cyclohexylalanine in Dmt-Tic-Cha-Phe peptides results in highly potent delta opioid antagonists.
Ref 528646J Med Chem. 2007 Feb 8;50(3):512-20.Synthesis and characterization of potent and selective mu-opioid receptor antagonists, [Dmt(1), D-2-Nal(4)]endomorphin-1 (Antanal-1) and [Dmt(1), D-2-Nal(4)]endomorphin-2 (Antanal-2).
Ref 528655Bioorg Med Chem Lett. 2007 Mar 15;17(6):1508-11. Epub 2007 Jan 17.High-affinity carbamate analogues of morphinan at opioid receptors.
Ref 528692J Med Chem. 2007 Mar 22;50(6):1414-7. Epub 2007 Feb 22.Dicarba analogues of the cyclic enkephalin peptides H-Tyr-c[D-Cys-Gly-Phe-D(or L)-Cys]NH(2) retain high opioid activity.
Ref 528724Bioorg Med Chem Lett. 2007 May 1;17(9):2656-60. Epub 2007 Feb 2.Further studies of tyrosine surrogates in opioid receptor peptide ligands.
Ref 528781Bioorg Med Chem Lett. 2007 Jun 1;17(11):3028-33. Epub 2007 Mar 21.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 2.
Ref 528785Bioorg Med Chem Lett. 2007 Jun 1;17(11):3023-7. Epub 2007 Mar 23.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 1.
Ref 528787Bioorg Med Chem. 2007 Jun 15;15(12):4106-12. Epub 2007 Mar 30.In-vitro investigation of oxazol and urea analogues of morphinan at opioid receptors.
Ref 528801J Nat Prod. 2007 May;70(5):872-5. Epub 2007 Apr 24.Indolizidine alkaloids with delta-opioid receptor binding affinity from the leaves of Elaeocarpus fuscoides.
Ref 528832J Med Chem. 2007 Jun 14;50(12):2753-66. Epub 2007 May 12.Bifunctional [2',6'-dimethyl-L-tyrosine1]endomorphin-2 analogues substituted at position 3 with alkylated phenylalanine derivatives yield potent mixed mu-agonist/delta-antagonist and dual mu-agonist/delta-agonist opioid ligands.
Ref 528853J Med Chem. 2007 Jun 14;50(12):2779-86. Epub 2007 May 22.Design, synthesis, and biological evaluation of novel bifunctional C-terminal-modified peptides for delta/mu opioid receptor agonists and neurokinin-1 receptor antagonists.
Ref 528875J Med Chem. 2007 Jun 28;50(13):3138-42. Epub 2007 Jun 1.Synthesis of stable and potent delta/mu opioid peptides: analogues of H-Tyr-c[D-Cys-Gly-Phe-D-Cys]-OH by ring-closing metathesis.
Ref 528947J Med Chem. 2007 Aug 9;50(16):3765-76. Epub 2007 Jul 11.Probes for narcotic receptor mediated phenomena. 34. Synthesis and structure-activity relationships of a potent mu-agonist delta-antagonist and an exceedingly potent antinociceptive in the enantiomeric C9-substituted 5-(3-hydroxyphenyl)-N-phenylethylmorphan series.
Ref 528996Bioorg Med Chem Lett. 2007 Oct 1;17(19):5349-52. Epub 2007 Aug 11.Structure-activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 1.
Ref 529041Bioorg Med Chem. 2007 Nov 15;15(22):6876-81. Epub 2007 Aug 29.A new opioid designed multiple ligand derived from the micro opioid agonist endomorphin-2 and the delta opioid antagonist pharmacophore Dmt-Tic.
Ref 529088J Med Chem. 2007 Nov 1;50(22):5528-32. Epub 2007 Oct 10.Development of novel enkephalin analogues that have enhanced opioid activities at both mu and delta opioid receptors.
Ref 529132Bioorg Med Chem Lett. 2007 Dec 15;17(24):6841-6. Epub 2007 Oct 17.Structure activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 2.
Ref 529173J Nat Prod. 2007 Dec;70(12):1946-50. Epub 2007 Nov 27.Alkaloids with human delta-opioid receptor binding affinity from the Australian rainforest tree Peripentadenia mearsii.
Ref 529202J Med Chem. 2008 Jan 10;51(1):173-7. Epub 2007 Dec 7.Endomorphin-2 with a beta-turn backbone constraint retains the potent micro-opioid receptor agonist properties.
Ref 529238Bioorg Med Chem. 2008 Mar 15;16(6):3218-23. Epub 2007 Dec 31.Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors.
Ref 529246Bioorg Med Chem. 2008 Mar 15;16(6):3032-8. Epub 2007 Dec 23.Role of benzimidazole (Bid) in the delta-opioid agonist pseudopeptide H-Dmt-Tic-NH-CH(2)-Bid (UFP-502).
Ref 529306J Med Chem. 2008 Mar 13;51(5):1369-76. Epub 2008 Feb 12.A structure-activity relationship study and combinatorial synthetic approach of C-terminal modified bifunctional peptides that are delta/mu opioid receptor agonists and neurokinin 1 receptor antagonists.
Ref 529395J Med Chem. 2008 Apr 24;51(8):2571-4. Epub 2008 Mar 28.Blood-brain barrier penetration by two dermorphin tetrapeptide analogues: role of lipophilicity vs structural flexibility.
Ref 529401J Med Chem. 2008 Apr 24;51(8):2421-31. Epub 2008 Apr 2.Herkinorin analogues with differential beta-arrestin-2 interactions.
Ref 529414Eur J Med Chem. 2008 Nov;43(11):2307-15. Epub 2008 Feb 29.Ligand binding to nucleic acids and proteins: Does selectivity increase with strength?.
Ref 529429Bioorg Med Chem. 2008 May 15;16(10):5653-64. Epub 2008 Mar 30.Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 6: Opioid receptor binding properties of cyclic variants of 8-carboxamidocyclazocine.
Ref 529480Bioorg Med Chem. 2008 Jun 15;16(12):6415-22. Epub 2008 May 3.Structure-activity study of endomorphin-2 analogs with C-terminal modifications by NMR spectroscopy and molecular modeling.
Ref 529508Differential antagonism of delta opioid agonists by naltrindole and its benzofuran analog (NTB) in mice: evidence for delta opioid receptor subtypes. J Pharmacol Exp Ther. 1991 May;257(2):676-80.
Ref 529556J Med Chem. 2008 Jul 24;51(14):4270-9. Epub 2008 Jun 24.New endomorphin analogues containing alicyclic beta-amino acids: influence on bioactive conformation and pharmacological profile.
Ref 529630J Med Chem. 2008 Aug 28;51(16):5109-17. Epub 2008 Aug 5.Further studies on lead compounds containing the opioid pharmacophore Dmt-Tic.
Ref 529642Design and synthesis of a metabolically stable and potent antitussive agent, a novel delta opioid receptor antagonist, TRK-851. Bioorg Med Chem. 2008 Sep 1;16(17):7956-67.
Ref 529689J Med Chem. 2008 Oct 9;51(19):5893-6. Epub 2008 Sep 13.Potent, orally bioavailable delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-4-(5-hydroxyspiro[chromene-2,4'-piperidine]-4-yl)benzamide (ADL5859).
Ref 529704J Med Chem. 2008 Sep 25;51(18):5866-70.Novel opioid peptide derived antagonists containing (2S)-2-methyl-3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid [(2S)-Mdcp].
Ref 529724J Med Chem. 2008 Oct 23;51(20):6334-47. Epub 2008 Sep 27.The importance of micelle-bound states for the bioactivities of bifunctional peptide derivatives for delta/mu opioid receptor agonists and neurokinin 1 receptor antagonists.
Ref 529816Bioorg Med Chem Lett. 2009 Jan 1;19(1):203-8. Epub 2008 Nov 7.Syntheses and opioid receptor binding properties of carboxamido-substituted opioids.
Ref 529871Bioorg Med Chem Lett. 2009 Jan 15;19(2):365-8. Epub 2008 Nov 24.Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 7: syntheses and opioid receptor properties of cyclic variants of cyclazocine.
Ref 529991J Med Chem. 2009 Mar 26;52(6):1553-7.14 beta-O-cinnamoylnaltrexone and related dihydrocodeinones are mu opioid receptor partial agonists with predominant antagonist activity.
Ref 530013Bioorg Med Chem Lett. 2009 Apr 15;19(8):2289-94. Epub 2009 Feb 25.Syntheses of novel high affinity ligands for opioid receptors.
Ref 530052Bioorg Med Chem Lett. 2009 May 1;19(9):2519-23. Epub 2009 Mar 14.The discovery of tropane derivatives as nociceptin receptor ligands for the management of cough and anxiety.
Ref 530073Bioorg Med Chem Lett. 2009 May 15;19(10):2792-5. Epub 2009 Mar 26.Design and synthesis of novel delta opioid receptor agonists and their pharmacologies.
Ref 530077Bioorg Med Chem Lett. 2009 May 15;19(10):2811-4. Epub 2009 Mar 26.Design, synthesis, and characterization of 6beta-naltrexol analogs, and their selectivity for in vitro opioid receptor subtypes.
Ref 530160Bioorg Med Chem Lett. 2009 Jul 1;19(13):3647-50. Epub 2009 May 3.Nascent structure-activity relationship study of a diastereomeric series of kappa opioid receptor antagonists derived from CJ-15,208.
Ref 530279J Med Chem. 2009 Dec 10;52(23):7389-96.Univalent and bivalent ligands of butorphan: characteristics of the linking chain determine the affinity and potency of such opioid ligands.
Ref 530324J Med Chem. 2009 Sep 24;52(18):5685-702.Spirocyclic delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-3-hydroxy-4-(spiro[chromene-2,4'-piperidine]-4-yl) benzamide (ADL5747).
Ref 530392Bioorg Med Chem. 2009 Oct 15;17(20):7337-43. Epub 2009 Aug 21.The biological activity and metabolic stability of peptidic bifunctional compounds that are opioid receptor agonists and neurokinin-1 receptor antagonists with a cystine moiety.
Ref 530428J Med Chem. 2009 Nov 12;52(21):6814-21.The effects of C-terminal modifications on the opioid activity of [N-benzylTyr(1)]dynorphin A-(1-11) analogues.
Ref 530447J Med Chem. 2009 Nov 12;52(21):6941-5.Agonist vs antagonist behavior of delta opioid peptides containing novel phenylalanine analogues in place of Tyr(1).
Ref 530461J Med Chem. 2009 Nov 12;52(21):6926-30.14beta-Arylpropiolylamino-17-cyclopropylmethyl-7,8-dihydronormorphinones and related opioids. Further examples of pseudoirreversible mu opioid receptor antagonists.
Ref 530529J Med Chem. 2010 Jan 14;53(1):402-18.Synthesis and opioid receptor binding affinities of 2-substituted and 3-aminomorphinans: ligands for mu, kappa, and delta opioid receptors.
Ref 530705Bioorg Med Chem Lett. 2010 Mar 1;20(5):1601-3. Epub 2010 Jan 22.Synthesis and evaluation of opioid receptor-binding affinity of elaeocarpenine and its analogs.
Ref 530707Bioorg Med Chem Lett. 2010 Mar 1;20(5):1507-9. Epub 2010 Jan 25.Effect of linker substitution on the binding of butorphan univalent and bivalent ligands to opioid receptors.
Ref 530780J Med Chem. 2010 Apr 8;53(7):2875-81."Carba"-analogues of fentanyl are opioid receptor agonists.
Ref 530876J Nat Prod. 2010 May 28;73(5):988-91.Hasubanan alkaloids with delta-opioid binding affinity from the aerial parts of Stephania japonica.
Ref 531038Bioorg Med Chem. 2010 Aug 15;18(16):6024-30. Epub 2010 Jun 25.Role of 2',6'-dimethyl-l-tyrosine (Dmt) in some opioid lead compounds.
Ref 531092Eur J Med Chem. 2010 Oct;45(10):4594-600. Epub 2010 Jul 21.Synthesis and activity of endomorphin-2 and morphiceptin analogues with proline surrogates in position 2.
Ref 531109Bioorg Med Chem Lett. 2010 Sep 15;20(18):5405-10. Epub 2010 Aug 3.SAR development of a series of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as kappa opioid receptor antagonists. Part 2.
Ref 531165Bioorg Med Chem Lett. 2010 Nov 1;20(21):6302-5. Epub 2010 Aug 21.Design and synthesis of KNT-127, a |A-opioid receptor agonist effective by systemic administration.
Ref 531414Preclinical pharmacology of AZD2327: a highly selective agonist of the delta-opioid receptor. J Pharmacol Exp Ther. 2011 Jul;338(1):195-204.
Ref 531519J Med Chem. 1990 Sep;33(9):2456-64.Photoactivatable opiate derivatives as irreversible probes of the mu-opioid receptor.
Ref 533358[3H][D-Ser2(O-tert-butyl),Leu5]enkephalyl-Thr6 and [D-Ser2(O-tert-butyl),Leu5]enkephalyl-Thr6(O-tert-butyl). Two new enkephalin analogs with both a good selectivity and a high affinity toward delta-opioid binding sites. J Biol Chem. 1988 Mar 25;263(9):4124-30.
Ref 533376J Med Chem. 1986 Nov;29(11):2370-5.Design and synthesis of conformationally constrained somatostatin analogues with high potency and specificity for mu opioid receptors.
Ref 533539J Med Chem. 1981 Jul;24(7):903-6.Synthesis of analogues of acetylmethadol and methadol as potential narcotic antagonists.
Ref 533543J Med Chem. 1982 Aug;25(8):913-9.Potential affinity labels for the opiate receptor based on fentanyl and related compounds.
Ref 533889J Med Chem. 1993 Mar 19;36(6):750-7.Design and synthesis of highly potent and selective cyclic dynorphin A analogs. 2. New analogs.
Ref 533937TIPP[psi]: a highly potent and stable pseudopeptide delta opioid receptor antagonist with extraordinary delta selectivity. J Med Chem. 1993 Oct 15;36(21):3182-7.
Ref 533971J Med Chem. 1994 Jan 7;37(1):141-5.Design of cyclic deltorphins and dermenkephalins with a disulfide bridge leads to analogues with high selectivity for delta-opioid receptors.
Ref 533972J Med Chem. 1994 Jan 7;37(1):146-50.Cyclic enkephalin analogs with exceptional potency at peripheral delta opioid receptors.
Ref 534004J Med Chem. 1993 Mar 19;36(6):708-19.A topochemical approach to explain morphiceptin bioactivity.
Ref 534018Cloning and functional comparison of kappa and delta opioid receptors from mouse brain. Proc Natl Acad Sci U S A. 1993 Jul 15;90(14):6736-40.
Ref 534460J Med Chem. 1997 Aug 29;40(18):2948-52.Synthesis and pharmacological activity of deltorphin and dermorphin-related glycopeptides.
Ref 534631J Med Chem. 1998 May 21;41(11):1980-90.Investigation of the N-substituent conformation governing potency and mu receptor subtype-selectivity in (+)-(3R, 4R)-dimethyl-4-(3-hydroxyphenyl)piperidine opioid antagonists.
Ref 534682Selective in vivo binding of [3H]naltriben to delta-opioid receptors in mouse brain. Eur J Pharmacol. 1998 Jun 5;350(2-3):335-44.
Ref 534953The antitussive activity of delta-opioid receptor stimulation in guinea pigs. J Pharmacol Exp Ther. 2000 Feb;292(2):803-9.
Ref 534987The TIPP opioid peptide family: development of delta antagonists, delta agonists, and mixed mu agonist/delta antagonists. Biopolymers. 1999;51(6):411-25.
Ref 534994Antiparkinson potential of delta-opioid receptor agonists. Eur J Pharmacol. 2000 May 19;396(2-3):101-7.
Ref 535092Delta opioid receptor stimulation mimics ischemic preconditioning in human heart muscle. J Am Coll Cardiol. 2000 Dec;36(7):2296-302.
Ref 535152Inverse agonist action of Leu-enkephalin at delta(2)-opioid receptors mediates spinal antianalgesia. J Pharmacol Exp Ther. 2001 May;297(2):582-9.
Ref 535207BW373U86, a delta opioid agonist, partially mediates delayed cardioprotection via a free radical mechanism that is independent of opioid receptor stimulation. J Mol Cell Cardiol. 2001 Aug;33(8):1455-65.
Ref 535235Agonist-, antagonist-, and inverse agonist-regulated trafficking of the delta-opioid receptor correlates with, but does not require, G protein activation. J Pharmacol Exp Ther. 2001 Sep;298(3):1015-20.
Ref 535449Nonpeptidic delta-opioid receptor agonists reduce immobility in the forced swim assay in rats. Neuropsychopharmacology. 2002 Jun;26(6):744-55.
Ref 535501Delta-opioid receptor antagonists as a new concept for central acting antitussive drugs. Pulm Pharmacol Ther. 2002;15(3):235-40.
Ref 535919Identification of opioid ligands possessing mixed micro agonist/delta antagonist activity among pyridomorphinans derived from naloxone, oxymorphone, and hydromorphone [correction of hydropmorphone]. J Med Chem. 2004 Mar 11;47(6):1400-12.
Ref 536098Butorphanol: effects of a prototypical agonist-antagonist analgesic on kappa-opioid receptors. J Pharmacol Sci. 2005 Jun;98(2):109-16. Epub 2005 Jun 8.
Ref 536427Oxycodone: a pharmacological and clinical review. Clin Transl Oncol. 2007 May;9(5):298-307.
Ref 536497Pharmacologic therapeutics for cardiac reperfusion injury. Expert Opin Emerg Drugs. 2007 Sep;12(3):367-88.
Ref 537660Cross-linking of human [125I]beta-endorphin to opioid receptors in rat striatal membranes: biochemical evidence for the existence of a mu/delta opioid receptor complex. J Pharmacol Exp Ther. 1990 Apr;253(1):419-26.
Ref 537722In vivo evidence for the selectivity of ICI 154129 for the delta-opioid receptor. Neuropharmacology. 1985 Feb;24(2):107-10.
Ref 537797Loperamide: evidence of interaction with mu and delta opioid receptors. Life Sci. 1983;33 Suppl 1:315-8.
Ref 537870Delta-opioid receptor agonists inhibit neuromuscular transmission in human colon. Eur J Pharmacol. 1994 Sep 1;262(1-2):33-9.
Ref 543762(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 317).
Ref 544320Molecular Mechanisms of Opioid Receptor-Dependent Signaling and Behavior. Anesthesiology. 2011 December; 115(6): 1363-1381.
Ref 547636Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018026)
Ref 550129WO patent application no. 2007,0677,14, Treatment of sequelae of psychiatric disorders.
Ref 550920US patent application no. 6,924,288, Enantiomerically pure opioid diarylmethylpiperzine and methods of using same.
Ref 551220Evaluation of N-substitution in 6,7-benzomorphan compounds. Bioorg Med Chem. 2010 Jul 15;18(14):4975-82. doi: 10.1016/j.bmc.2010.06.005. Epub 2010 Jun 9.
Ref 551355Akuammine and dihydroakuammine, two indolomonoterpene alkaloids displaying affinity for opioid receptors. J Nat Prod. 1992 Mar;55(3):380-4.
Ref 551379Opiate receptor binding properties of morphine-, dihydromorphine-, and codeine 6-O-sulfate ester congeners. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4291-5. Epub 2006 Jun 13.
Ref 551387[6-O-methyl-11C]Diprenorphine, Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013. 2006 May 24 [updated 2007 May 12].
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
Ref 551402Subramanian G, Paterlini MG, Portoghese PS, Ferguson DM: Molecular docking reveals a novel binding site model for fentanyl at the mu-opioid receptor. J Med Chem. 2000 Feb 10;43(3):381-91.
Ref 551406Wax PM, Becker CE, Curry SC: Unexpected “gas” casualties in Moscow: a medical toxicology perspective. Ann Emerg Med. 2003 May;41(5):700-5.
Ref 551408You HJ, Colpaert FC, Arendt-Nielsen L: The novel analgesic and high-efficacy 5-HT1A receptor agonist F 13640 inhibits nociceptive responses, wind-up, and after-discharges in spinal neurons and withdrawal reflexes. Exp Neurol. 2005 Jan;191(1):174-83.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.