Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T16987
|
||||
Former ID |
TTDR00212
|
||||
Target Name |
Carbonic anhydrase XII
|
||||
Gene Name |
CA12
|
||||
Synonyms |
CA-XII; Carbonate dehydratase XII; Tumor antigen HOM-RCC-3.1.3; CA12
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Function |
Reversible hydration of carbon dioxide.
|
||||
BioChemical Class |
Carbon-oxygen lyases
|
||||
Target Validation |
T16987
|
||||
UniProt ID | |||||
EC Number |
EC 4.2.1.1
|
||||
Sequence |
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA |
||||
Drugs and Mode of Action | |||||
Drug(s) | MAFENIDE | Drug Info | Approved | Bacterial infection | [1] |
SALICYLATE | Drug Info | Phase 4 | Discovery agent | [2] | |
Curcumin | Drug Info | Phase 3 | Cancer | [3], [4] | |
PARABEN | Drug Info | Phase 3 | Discovery agent | [5] | |
PHENOL | Drug Info | Phase 2/3 | Discovery agent | [6] | |
COUMATE | Drug Info | Phase 2 | Breast cancer | [7] | |
Inhibitor | 1,4-Dihydro-1-methyl-4-oxo-3-pyridinesulfonamide | Drug Info | [8] | ||
1-Benzyl-1,4-dihydro-4-oxo-3-pyridinesulfonamide | Drug Info | [8] | |||
2,2,2-Trifluoro-N-(4-sulfamoyl-phenyl)-acetamide | Drug Info | [9] | |||
2,2-Dimethyl-N-(4-sulfamoyl-phenyl)-propionamide | Drug Info | [9] | |||
2,3-dihydro-1H-indene-5-sulfonamide | Drug Info | [10] | |||
2,4-Disulfamyltrifluoromethylaniline | Drug Info | [11] | |||
2-acetamido-2,3-dihydro-1H-indene-5-sulfonic acid | Drug Info | [10] | |||
2-amino-2,3-dihydro-1H-indene-5-sulfonamide | Drug Info | [10] | |||
2-Amino-benzenesulfonamide | Drug Info | [11] | |||
2-Amino-indan-5-sulfonic acid | Drug Info | [10] | |||
2-hydrazinylbenzenesulfonamide | Drug Info | [11] | |||
2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [12] | |||
2-oxo-2H-thiochromene-3-carboxylic acid | Drug Info | [12] | |||
3-((4-aminophenyl)diazenyl)benzenesulfonamide | Drug Info | [13] | |||
3-((4-hydroxyphenyl)diazenyl)benzenesulfonamide | Drug Info | [13] | |||
3-(3-Phenyl-ureido)-benzenesulfonamide | Drug Info | [9] | |||
3-(4'-Hydroxyphenyl)diazenylbenzenesulfonamide | Drug Info | [13] | |||
3-Amino-benzenesulfonamide | Drug Info | [14] | |||
4,4'-thiodipyridine-3-sulfonamide | Drug Info | [15] | |||
4-((4-hydroxyphenyl)diazenyl)benzenesulfonamide | Drug Info | [13] | |||
4-(2-Amino-ethyl)-benzenesulfonamide | Drug Info | [11] | |||
4-(2-Hydroxy-ethyl)-benzenesulfonamide | Drug Info | [11] | |||
4-(2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide | Drug Info | [15] | |||
4-(2-Propynylthio)pyridine-3-sulfonamide | Drug Info | [15] | |||
4-(4'-N-Methylphenyl)diazenylbenzenesulfonamide | Drug Info | [13] | |||
4-(4-Cyanophenoxy)-3-pyridinesulfonamide | Drug Info | [15] | |||
4-(4-Fluorophenoxy)-3-pyridinesulfonamide | Drug Info | [15] | |||
4-(5-Methyl-2-pirazolino)-3-pyridinesulfonamide | Drug Info | [15] | |||
4-(Allylamino)-3-pyridinesulfonamide | Drug Info | [15] | |||
4-(Carbamolymethylthio)pyridine-3-sulfonamide | Drug Info | [15] | |||
4-(Cyanomethylthio)pyridine-3-sulfonamide | Drug Info | [15] | |||
4-(hydroxymethyl)benzenesulfonamide | Drug Info | [11] | |||
4-(Methylhydrazino)-3-pyridinesulfonamide | Drug Info | [15] | |||
4-(N-Methyl-hydrazino)-benzenesulfonamide | Drug Info | [11] | |||
4-(N-Oxide-2-pyridylthio)pyridine-3-sulfonamide | Drug Info | [15] | |||
4-(Quinolinoxy)-3-pyridinesulfonamide | Drug Info | [15] | |||
4-Amino-3-bromo-benzenesulfonamide | Drug Info | [11] | |||
4-Amino-3-chloro-benzenesulfonamide | Drug Info | [11] | |||
4-Amino-3-fluoro-benzenesulfonamide | Drug Info | [11] | |||
4-Amino-3-iodo-benzenesulfonamide | Drug Info | [11] | |||
4-Benzenesulfonylamino-benzenesulfonamide | Drug Info | [9] | |||
4-Benzythiopyridine-3-sulfonamide | Drug Info | [15] | |||
4-CYANOPHENOL | Drug Info | [16] | |||
4-Ethoxy-3-pyridinesulfonamide | Drug Info | [15] | |||
4-Hydrazino-3-pyridinesulfonamide | Drug Info | [15] | |||
4-Hydrazino-benzenesulfonamide | Drug Info | [14] | |||
4-Methanesulfonylamino-benzenesulfonamide | Drug Info | [9] | |||
4-Methoxy-3-pyridinesulfonamide | Drug Info | [15] | |||
4-Methylamino-benzenesulfonamide | Drug Info | [11] | |||
4-Methylthiopyridine-3-sulfonamide | Drug Info | [15] | |||
4-[2-(3-Phenyl-ureido)-ethyl]-benzenesulfonamide | Drug Info | [9] | |||
5-amino-1,3,4-thiadiazole-2-sulfonamide | Drug Info | [17] | |||
6-(aminomethyl)-2H-chromen-2-one | Drug Info | [12] | |||
6-(hydroxymethyl)-2H-chromen-2-one | Drug Info | [12] | |||
6-Hydroxy-benzothiazole-2-sulfonic acid amide | Drug Info | [11] | |||
6-methoxy-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [12] | |||
6-methyl-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [12] | |||
7-(benzyloxy)-2H-chromen-2-one | Drug Info | [12] | |||
7-butoxy-2H-chromen-2-one | Drug Info | [12] | |||
7-methoxy-2-oxo-2H-chromene-4-carboxylic acid | Drug Info | [12] | |||
7-phenethoxy-2H-chromen-2-one | Drug Info | [12] | |||
7-propoxy-2H-chromen-2-one | Drug Info | [12] | |||
8-methoxy-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [12] | |||
ACETYLSULFANILAMIDE | Drug Info | [9] | |||
BENZOLAMIDE | Drug Info | [11] | |||
Carzenide | Drug Info | [11] | |||
CATECHIN | Drug Info | [18] | |||
CATECHOL | Drug Info | [19] | |||
COUMARIN | Drug Info | [12] | |||
COUMATE | Drug Info | [20] | |||
Curcumin | Drug Info | [18] | |||
Decane-1,10-diyl disulfamate | Drug Info | [21] | |||
Decyl sulfamate | Drug Info | [21] | |||
ELLAGIC ACID | Drug Info | [19] | |||
ETHOXYCOUMARIN | Drug Info | [12] | |||
Ethyl 7-methoxy-2-oxo-2H-chromene-3-carboxylate | Drug Info | [12] | |||
FERULIC ACID | Drug Info | [19] | |||
GALLICACID | Drug Info | [19] | |||
HERNIARIN | Drug Info | [12] | |||
Hexane-1,6-diamine | Drug Info | [22] | |||
MAFENIDE | Drug Info | [1] | |||
N-(4-cyanophenyl)sulfamide | Drug Info | [23] | |||
N-(4-Sulfamoyl-phenyl)-benzamide | Drug Info | [9] | |||
N-(4-Sulfamoyl-phenyl)-butyramide | Drug Info | [9] | |||
N-(4-Sulfamoyl-phenyl)-isobutyramide | Drug Info | [9] | |||
N-(4-Sulfamoyl-phenyl)-propionamide | Drug Info | [9] | |||
N-(pentafluorophenyl)sulfamide | Drug Info | [23] | |||
N-hydroxysulfamide | Drug Info | [24] | |||
N-propynyl amidebenzenesulphonide | Drug Info | [25] | |||
N1-(2-aminoethyl)ethane-1,2-diamine | Drug Info | [22] | |||
N1-(naphthalen-1-yl)ethane-1,2-diamine | Drug Info | [22] | |||
Octane-1,8-diyl disulfamate | Drug Info | [21] | |||
Octyl sulfamate | Drug Info | [21] | |||
P-Coumaric Acid | Drug Info | [19] | |||
P-TOLUENESULFONAMIDE | Drug Info | [11] | |||
PARABEN | Drug Info | [19] | |||
Pentane-1,5-diamine | Drug Info | [22] | |||
Pentanoic acid (4-sulfamoyl-phenyl)-amide | Drug Info | [9] | |||
PHENOL | Drug Info | [18] | |||
Prop-2-ynyl 4-sulfamoylbenzoate | Drug Info | [25] | |||
RESORCINOL | Drug Info | [16] | |||
SACCHARIN | Drug Info | [26] | |||
SALICYLATE | Drug Info | [16] | |||
Sodium N-methylphenylaminomethanesulfonate | Drug Info | [13] | |||
Sodium phenylaminomethanesulfonate | Drug Info | [13] | |||
Sulfanilamide derivative | Drug Info | [27] | |||
Syringic Acid | Drug Info | [19] | |||
Thioureido sulfonamide | Drug Info | [28] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Nitrogen metabolism | ||||
NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
Reactome | Reversible hydration of carbon dioxide | ||||
WikiPathways | Reversible Hydration of Carbon Dioxide | ||||
miR-targeted genes in muscle cell - TarBase | |||||
miR-targeted genes in leukocytes - TarBase | |||||
miR-targeted genes in epithelium - TarBase | |||||
References | |||||
REF 1 | J Med Chem. 2010 Apr 8;53(7):2913-26.Sulfonamide linked neoglycoconjugates--a new class of inhibitors for cancer-associated carbonic anhydrases. | ||||
REF 2 | ClinicalTrials.gov (NCT01712295) 17% Salicylate Versus 17% Salicylate-Ethyl Pyruvate for Plantar Foot Warts. U.S. National Institutes of Health. | ||||
REF 3 | Nanocurcumin: a promising therapeutic advancement over native curcumin. Crit Rev Ther Drug Carrier Syst. 2013;30(4):331-68. | ||||
REF 4 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7000). | ||||
REF 5 | ClinicalTrials.gov (NCT01688479) Trial Comparing Calendula Officinalis With Aqueous Cream "Essex" to Treat Skin Reactions From Radiotherapy of Breast Cancer. U.S. National Institutes of Health. | ||||
REF 6 | ClinicalTrials.gov (NCT02527187) Determination of the Sensitivity and Specificity of Prick Test Betula Verrucosa. | ||||
REF 7 | Irosustat: a first-generation steroid sulfatase inhibitor in breast cancer. Expert Rev Anticancer Ther. 2011 Feb;11(2):179-83. | ||||
REF 8 | Eur J Med Chem. 2010 Sep;45(9):3656-61. Epub 2010 May 12.Carbonic anhydrase inhibitors. Regioselective synthesis of novel 1-substituted 1,4-dihydro-4-oxo-3-pyridinesulfonamides and their inhibition of the human cytosolic isozymes I and II and transmembrane cancer-associated isozymes IX and XII. | ||||
REF 9 | Bioorg Med Chem Lett. 2005 Nov 1;15(21):4862-6.Carbonic anhydrase inhibitors: inhibition of the tumor-associated isozymes IX and XII with a library of aromatic and heteroaromatic sulfonamides. | ||||
REF 10 | Eur J Med Chem. 2008 Dec;43(12):2853-60. Epub 2008 Feb 29.Indanesulfonamides as carbonic anhydrase inhibitors and anticonvulsant agents: structure-activity relationship and pharmacological evaluation. | ||||
REF 11 | Bioorg Med Chem Lett. 2005 Feb 15;15(4):963-9.Carbonic anhydrase inhibitors. Inhibition of the transmembrane isozyme XII with sulfonamides-a new target for the design of antitumor and antiglaucoma drugs?. | ||||
REF 12 | J Med Chem. 2010 Jan 14;53(1):335-44.Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. | ||||
REF 13 | Bioorg Med Chem. 2009 Oct 15;17(20):7093-9. Epub 2009 Sep 6.Carbonic anhydrase inhibitors. Diazenylbenzenesulfonamides are potent and selective inhibitors of the tumor-associated isozymes IX and XIIover the cytosolic isoforms I and II. | ||||
REF 14 | Bioorg Med Chem Lett. 2005 Sep 1;15(17):3828-33.Carbonic anhydrase inhibitors: inhibition of the transmembrane isozyme XIV with sulfonamides. | ||||
REF 15 | Eur J Med Chem. 2010 Jun;45(6):2396-404. Epub 2010 Feb 12.Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associated) and XIV with 4-substituted 3-pyridinesulfonamides. | ||||
REF 16 | Bioorg Med Chem. 2008 Aug 1;16(15):7424-8. Epub 2008 Jun 13.Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. | ||||
REF 17 | Bioorg Med Chem Lett. 2010 Aug 1;20(15):4376-81. Epub 2010 Jun 17.Carbonic anhydrase inhibitors. The X-ray crystal structure of human isoform II in adduct with an adamantyl analogue of acetazolamideresides in a less utilized binding pocket than most hydrophobic inhibitors. | ||||
REF 18 | Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3. Epub 2010 Jul 13.Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. | ||||
REF 19 | Bioorg Med Chem. 2010 Mar 15;18(6):2159-64. Epub 2010 Feb 6.Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. | ||||
REF 20 | Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6. Epub 2008 Jul 5.Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-ray crystallographic studies. | ||||
REF 21 | J Med Chem. 2009 Oct 8;52(19):5990-8.Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-binding, more isoform-selective inhibitors. | ||||
REF 22 | J Med Chem. 2010 Aug 12;53(15):5511-22.Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. | ||||
REF 23 | Bioorg Med Chem Lett. 2005 May 2;15(9):2353-8.Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with N-hydroxysulfamides--a new zinc-binding function in the design of inhibitors. | ||||
REF 24 | Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5. Epub 2010 Apr 28.Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mammalian isoforms I-XV. | ||||
REF 25 | Bioorg Med Chem Lett. 2007 Feb 15;17(4):987-92. Epub 2006 Nov 17.Inhibition of membrane-associated carbonic anhydrase isozymes IX, XII and XIV with a library of glycoconjugate benzenesulfonamides. | ||||
REF 26 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):836-41. Epub 2007 Nov 13.Carbonic anhydrase inhibitors: copper(II) complexes of polyamino-polycarboxylamido aromatic/heterocyclic sulfonamides are very potentinhibitors of the tumor-associated isoforms IX and XII. | ||||
REF 27 | Bioorg Med Chem Lett. 2005 Jun 15;15(12):3096-101.Carbonic anhydrase inhibitors. Inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with Schiff's bases incorporating chromone and aromatic sulfonamide moieties, and their zinc complexes. | ||||
REF 28 | Bioorg Med Chem Lett. 2005 Sep 1;15(17):3821-7.Carbonic anhydrase inhibitors: design of thioureido sulfonamides with potent isozyme II and XII inhibitory properties and intraocular pressure lowering activity in a rabbit model of glaucoma. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.