Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T13260
|
||||
Former ID |
TTDS00252
|
||||
Target Name |
Cytochrome P450 19
|
||||
Gene Name |
CYP19A1
|
||||
Synonyms |
Aromatase; CYPXIX; Estrogen synthetase; P-450AROM; CYP19A1
|
||||
Target Type |
Successful
|
||||
Disease | Advanced breast cancer [ICD9: 174, 175; ICD10: C50] | ||||
Bladder cancer [ICD9: 188; ICD10: C67] | |||||
Breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
Cushing's disease; Metastatic breast cancer [ICD9: 174, 175, 255.0; ICD10: C50, E24] | |||||
Dermatological disease [ICD10: L00-L99] | |||||
Endometriosis [ICD9: 617; ICD10: N80] | |||||
Hormonally-responsive breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
Prostate disease [ICD10: N42.9] | |||||
Painful diabetic neuropathy [ICD9: 250.6,338,780; ICD10: E10.4, E11.4, E13.4, G89, R52] | |||||
Unspecified [ICD code not available] | |||||
Function |
Catalyzesthe formation of aromatic C18 estrogens from C19 androgens.
|
||||
BioChemical Class |
Oxidoreductases acting on paired donors
|
||||
Target Validation |
T13260
|
||||
UniProt ID | |||||
EC Number |
EC 1.14.14.1
|
||||
Sequence |
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH PDETKNMLEMIFTPRNSDRCLEH |
||||
Drugs and Mode of Action | |||||
Drug(s) | Aminoglutethimide | Drug Info | Approved | Cushing's disease; Metastatic breast cancer | [1], [2] |
Anastrozole | Drug Info | Approved | Breast cancer | [3], [4] | |
Exemestane | Drug Info | Approved | Hormonally-responsive breast cancer | [5], [6] | |
FADROZOLE | Drug Info | Approved | Breast cancer | [7], [8], [9] | |
Letrozole | Drug Info | Approved | Hormonally-responsive breast cancer | [10], [4] | |
Testolactone | Drug Info | Approved | Advanced breast cancer | [5], [11] | |
Atamestane-plus- Toremifene | Drug Info | Phase 3 | Breast cancer | [12] | |
LIAROZOLE | Drug Info | Phase 2/3 | Dermatological disease | [13], [14] | |
BGS-649 | Drug Info | Phase 2 | Endometriosis | [15] | |
COUMATE | Drug Info | Phase 2 | Breast cancer | [16] | |
Dextromethorphan+quinidine | Drug Info | Phase 2 | Painful diabetic neuropathy | [17] | |
NARINGENIN | Drug Info | Phase 1 | Discovery agent | [18] | |
FORMESTANE | Drug Info | Withdrawn from market | Breast cancer | [19], [9] | |
FINROZOLE | Drug Info | Discontinued in Phase 2 | Prostate disease | [20] | |
NKS-01 | Drug Info | Discontinued in Phase 2 | Bladder cancer | [21] | |
VOROZOLE | Drug Info | Discontinued in Phase 2 | Discovery agent | [22] | |
YM-511 | Drug Info | Discontinued in Phase 2 | Breast cancer | [23] | |
MINAMESTANE | Drug Info | Terminated | Bladder cancer | [24] | |
Rogletimide | Drug Info | Terminated | Breast cancer | [25] | |
Inhibitor | (+/-)-7-methoxy-2-(4-methoxyphenyl)chroman-4-one | Drug Info | [26] | ||
(+/-)-7-methoxy-2-phenylchroman-4-one | Drug Info | [27] | |||
(2S)-5,7,2',4'-tetrahydroxyflavanone | Drug Info | [28] | |||
(2S)-abyssinone II | Drug Info | [28] | |||
(2S)-euchrenone a7 | Drug Info | [28] | |||
1-(1-Benzyl-2-biphenyl-4-yl-ethyl)-1H-imidazole | Drug Info | [29] | |||
1-(2-(benzo[b]thiophen-4-yl)ethyl)-1H-imidazole | Drug Info | [30] | |||
1-(2-phenoxybenzyl)-1H-imidazole | Drug Info | [31] | |||
1-(3-(4-fluorophenyl)propyl)-1H-imidazole | Drug Info | [32] | |||
1-(3-Methoxy-naphthalen-2-yl)-1H-imidazole | Drug Info | [33] | |||
1-(4-Aminophenyl)-2-(1H-imidazol-1-yl)ethanone | Drug Info | [34] | |||
1-(4-Cyanobenzyl)-5-methyl-1H-imidazole | Drug Info | [35] | |||
1-(4-nitro-2-phenoxybenzyl)-1H-imidazole | Drug Info | [31] | |||
1-(4-Nitro-2-phenylsulfanylbenzyl)-1H-imidazole | Drug Info | [31] | |||
1-(7-Methoxy-2-phenyl-chroman-4-yl)-1H-imidazole | Drug Info | [36] | |||
1-(9-phenyl-9H-fluoren-9-yl)-1H-1,2,4-triazole | Drug Info | [30] | |||
1-(9-Phenyl-9H-fluoren-9-yl)1H-imidazole | Drug Info | [32] | |||
1-(9H-fluoren-9-yl)-1H-imidazole | Drug Info | [30] | |||
1-(biphenyl-3-ylmethyl)-1H-1,2,4-triazole | Drug Info | [37] | |||
1-Bromo-4-imidazol-1-ylmethyl-xanthen-9-one | Drug Info | [38] | |||
1-Ethyl-5-(imidazol-1-yl-phenyl-methyl)-1H-indole | Drug Info | [39] | |||
1-Imidazol-1-ylmethyl-4-nitro-xanthen-9-one | Drug Info | [38] | |||
1-Imidazol-1-ylmethylxanthen-9-one | Drug Info | [31] | |||
1-Naphthalen-2-yl-1H-imidazole | Drug Info | [33] | |||
1-[(7-Fluoronaphth-2-yl)methyl]-1H-imidazole | Drug Info | [32] | |||
10-EPI-8-DEOXY-CUMAMBRIN B | Drug Info | [32] | |||
11BETA,13-DIHYDRO-10-EPI-8-DEOXYCUMAM-BRIN B | Drug Info | [32] | |||
2,3,4-Trimethoxy-4'-amino-trans-stilbene | Drug Info | [34] | |||
2,3,5-Trimethoxy-4'-amino-trans-stilbene | Drug Info | [34] | |||
2,3-Dimethoxy-4'-amino-trans-stilbene | Drug Info | [34] | |||
2,4-Dimethoxy-3'-amino-trans-stilbene | Drug Info | [34] | |||
2,4-Dimethoxy-4'-amino-trans-stilbene | Drug Info | [34] | |||
2,5-Dimethoxy-4'-amino-trans-stilbene | Drug Info | [34] | |||
2-(1H-Imidazol-1-yl)-1-(4-nitrophenyl)ethanone | Drug Info | [34] | |||
2-(3-hydroxyphenyl)-7-methoxychroman-4-one | Drug Info | [27] | |||
2-(4-hydroxyphenyl)-7-methoxychroman-4-one | Drug Info | [27] | |||
2-Imidazol-1-yl-7-methoxy-3-phenyl-chromen-4-one | Drug Info | [40] | |||
2-Imidazol-1-ylmethylxanthen-9-one | Drug Info | [31] | |||
2-phenyl-2,3-dihydrobenzo[h]chromen-4-one | Drug Info | [27] | |||
2-Phenyl-3-pyridin-4-ylmethylene-chroman-4-one | Drug Info | [41] | |||
2-Phenyl-4-[1,2,4]triazol-1-yl-chroman-7-ol | Drug Info | [36] | |||
3,4'-(Ethane-1,2-diyl)dibenzenamine | Drug Info | [34] | |||
3,4,5-Trimethoxy-3'-amino-trans-stilbene | Drug Info | [34] | |||
3,4,5-Trimethoxy-4'-amino-trans-stilbene | Drug Info | [34] | |||
3,4-bis(3,4-dimethoxyphenyl)furan-2(5H)-one | Drug Info | [32] | |||
3,4-Dimethoxy-4'-amino-trans-stilbene | Drug Info | [34] | |||
3,5-Diacetoxy-4'-amino-trans-stilbene | Drug Info | [34] | |||
3,5-Diamino-4'-amino-trans-stilbene | Drug Info | [34] | |||
3,5-Dihydroxyl-4'-amino-trans-stilbene | Drug Info | [34] | |||
3,5-Dimethoxy-4'-amino-trans-stilbene | Drug Info | [34] | |||
3-((1H-imidazol-1-yl)methyl)-9H-xanthen-9-one | Drug Info | [31] | |||
3-(1-ethyl-3,4-dihydronaphthalen-2-yl)-pyridine | Drug Info | [42] | |||
3-(1-methyl-3,4-dihydronaphthalen-2-yl)-pyridine | Drug Info | [42] | |||
3-(2,2-Diphenyl-vinyl)-pyridine | Drug Info | [43] | |||
3-(3,4-dihydronaphthalen-2-yl)pyridine | Drug Info | [42] | |||
3-(3-methyl-3,4-dihydronaphthalen-2-yl)pyridine | Drug Info | [42] | |||
3-(4-Amino-phenyl)-1-methyl-pyrrolidine-2,5-dione | Drug Info | [44] | |||
3-(4-Amino-phenyl)-3-butyl-piperidine-2,6-dione | Drug Info | [45] | |||
3-(4-Amino-phenyl)-3-ethyl-pyrrolidine-2,5-dione | Drug Info | [44] | |||
3-(4-Amino-phenyl)-3-heptyl-piperidine-2,6-dione | Drug Info | [45] | |||
3-(4-Amino-phenyl)-3-hexyl-piperidine-2,6-dione | Drug Info | [45] | |||
3-(4-Amino-phenyl)-3-methyl-pyrrolidine-2,5-dione | Drug Info | [44] | |||
3-(4-Amino-phenyl)-3-pentyl-piperidine-2,6-dione | Drug Info | [45] | |||
3-(4-Amino-phenyl)-3-propyl-piperidine-2,6-dione | Drug Info | [45] | |||
3-(4-Amino-phenyl)-pyrrolidine-2,5-dione | Drug Info | [44] | |||
3-(4-methyl-3,4-dihydronaphthalen-2-yl)pyridine | Drug Info | [42] | |||
3-(5-Bromo-6-methoxy-naphthalen-2-yl)-pyridine | Drug Info | [33] | |||
3-(5-Chloro-6-methoxy-naphthalen-2-yl)-pyridine | Drug Info | [33] | |||
3-(6-Ethoxy-naphthalen-2-yl)-pyridine | Drug Info | [33] | |||
3-(6-methoxy-3,4-dihydronaphthalen-2-yl)pyridine | Drug Info | [42] | |||
3-(6-methoxynaphthalen-2-yl)pyridine | Drug Info | [46] | |||
3-(imidazolylmethyl)-4'-methoxyflavone | Drug Info | [47] | |||
3-(imidazolylmethyl)-4'-nitroflavone | Drug Info | [47] | |||
3-(imidazolylmethyl)-7-methoxy-4'-nitroflavone | Drug Info | [47] | |||
3-(imidazolylmethyl)flavone | Drug Info | [47] | |||
3-(naphthalen-2-yl)pyridine | Drug Info | [46] | |||
3-Amino-4'-amino-trans-stilbene | Drug Info | [34] | |||
3-Fluoren-9-ylidenemethyl-pyridine | Drug Info | [43] | |||
3-Fluoro-4'-(pyridin-4-ylmethyl)biphenyl-4-ol | Drug Info | [48] | |||
3-Indan-(1E)-ylidenemethyl-pyridine | Drug Info | [43] | |||
3-Indan-(1Z)-ylidenemethyl-pyridine | Drug Info | [43] | |||
3-Methoxyl-4'-amino-trans-stilbene | Drug Info | [34] | |||
3-Nitro-4'-nitro-trans-stilbene | Drug Info | [34] | |||
3-[3-Methyl-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[3-Methyl-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[3-Phenyl-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[4-Chloro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[4-Chloro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[4-Fluoro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[4-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[4-Methyl-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[4-Methyl-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[5-Bromo-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[5-Bromo-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[5-Chloro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[5-Chloro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[5-Ethoxy-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[5-Ethoxy-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[5-Methoxy-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[5-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[6-Methoxy-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[6-Methyl-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[6-Methyl-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
3-[7-Methoxy-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
4'-(Pyridin-4-ylmethyl)biphenyl-3,4-diol | Drug Info | [48] | |||
4'-(Pyridin-4-ylmethyl)biphenyl-3-amine | Drug Info | [48] | |||
4'-bromo-3-(imidazolylmethyl)-7-methoxyflavone | Drug Info | [47] | |||
4'-bromo-3-(imidazolylmethyl)flavone | Drug Info | [47] | |||
4'-cyano-3-(imidazolylmethyl)-7-methoxyflavone | Drug Info | [47] | |||
4'-cyano-3-(imidazolylmethyl)flavone | Drug Info | [47] | |||
4-((1H-imidazol-1-yl)methyl)-2H-chromen-2-one | Drug Info | [30] | |||
4-((1H-imidazol-1-yl)methyl)benzonitrile | Drug Info | [35] | |||
4-(1-Imidazol-1-yl-vinyl)-benzonitrile | Drug Info | [49] | |||
4-(2,2-Diphenyl-vinyl)-pyridine | Drug Info | [43] | |||
4-(2-(1H-imidazol-1-yl)ethoxy)-2H-chromen-2-one | Drug Info | [30] | |||
4-(3,4,5-Trimethoxyphenethyl)aniline | Drug Info | [34] | |||
4-(3,4-Dimethoxyphenethyl)aniline | Drug Info | [34] | |||
4-(3,5-Dimethoxyphenethyl)benzenamine | Drug Info | [34] | |||
4-ANDROSTENE-3-17-DIONE | Drug Info | [50] | |||
4-Bromo-1-imidazol-1-ylmethyl-xanthen-9-one | Drug Info | [38] | |||
4-Fluoren-9-ylidenemethyl-pyridine | Drug Info | [43] | |||
4-Imidazol-1-yl-2-phenyl-chroman-7-ol | Drug Info | [36] | |||
4-Imidazol-1-ylmethyl-1-nitro-xanthen-9-one | Drug Info | [38] | |||
4-Imidazol-1-ylmethyl-1-nitrothioxanthen-9-one | Drug Info | [31] | |||
4-Imidazol-1-ylmethyl-2-nitroxanthen-9-one | Drug Info | [31] | |||
4-Imidazol-1-ylmethyl-3-nitroxanthen-9-one | Drug Info | [31] | |||
4-Imidazol-1-ylmethylthioxanthen-9-one | Drug Info | [31] | |||
4-Imidazol-1-ylmethylxanthen-9-one | Drug Info | [31] | |||
4-Indan-(1E)-ylidenemethyl-pyridine | Drug Info | [43] | |||
4-Indan-(1Z)-ylidenemethyl-pyridine | Drug Info | [43] | |||
4-[(3'-Hydroxybiphenyl-4-yl)methyl]pyridine | Drug Info | [48] | |||
4-[(4'-Hydroxybiphenyl-4-yl)methyl]pyridine | Drug Info | [48] | |||
4-[5-Bromo-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
4-[5-Chloro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
4-[5-Chloro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
4-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
4-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
4-[5-Methoxy-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
4-[5-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
4-[6-Methoxy-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
4-[6-Methoxy-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
4-[6-Methyl-indan-(1E)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
4-[6-Methyl-indan-(1Z)-ylidenemethyl]-pyridine | Drug Info | [43] | |||
5-((1H-imidazol-1-yl)methyl)-7,8-dihydroquinoline | Drug Info | [30] | |||
5-(2-(1H-imidazol-1-yl)ethyl)quinoline | Drug Info | [30] | |||
5-Bromo-8-imidazol-1-ylmethyl-chromen-4-one | Drug Info | [38] | |||
5-Indan-(1E)-ylidenemethyl-1H-imidazole | Drug Info | [51] | |||
5-Indan-(1Z)-ylidenemethyl-1H-imidazole | Drug Info | [51] | |||
5-Pyridin-3-yl-1,3-dihydro-2H-indol-2-one | Drug Info | [46] | |||
5-Pyridin-3-yl-2,3-dihydro-1H-inden-1-one | Drug Info | [46] | |||
5-[5-Bromo-indan-(1E)-ylidenemethyl]-1H-imidazole | Drug Info | [51] | |||
5-[5-Bromo-indan-(1Z)-ylidenemethyl]-1H-imidazole | Drug Info | [51] | |||
5-[5-Fluoro-indan-(1E)-ylidenemethyl]-pyrimidine | Drug Info | [43] | |||
5-[5-Fluoro-indan-(1Z)-ylidenemethyl]-pyrimidine | Drug Info | [43] | |||
5-[5-Methoxy-indan-(1E)-ylidenemethyl]-thiazole | Drug Info | [43] | |||
5-[5-Methoxy-indan-(1Z)-ylidenemethyl]-thiazole | Drug Info | [43] | |||
6-((1H-imidazol-1-yl)methyl)-2H-chromene-2-thione | Drug Info | [30] | |||
6-Imidazol-1-yl-isoquinoline | Drug Info | [30] | |||
7,4'-Dihydroxyflavone | Drug Info | [32] | |||
7-((1H-imidazol-1-yl)methyl)-2H-chromen-2-one | Drug Info | [30] | |||
7-((1H-imidazol-1-yl)methyl)-4H-chromen-4-one | Drug Info | [30] | |||
7-((1H-imidazol-1-yl)methyl)isoquinoline | Drug Info | [30] | |||
7-(2-(1H-imidazol-1-yl)ethoxy)-2H-chromen-2-one | Drug Info | [52] | |||
7-hydroxy-2-(3-hydroxyphenyl)chroman-4-one | Drug Info | [27] | |||
7-hydroxy-2-phenylchroman-4-one | Drug Info | [27] | |||
7-[1,2,4]Triazol-4-ylmethyl-chromen-4-one | Drug Info | [38] | |||
8-Imidazol-1-ylmethyl-5-nitro-chromen-4-one | Drug Info | [38] | |||
9-Hydroxy-7,8-benzoflavone | Drug Info | [32] | |||
ALBANOL A | Drug Info | [28] | |||
ALPHA-NAPHTHOFLAVONE | Drug Info | [32] | |||
Aminoglutethemide | Drug Info | [53] | |||
Aminoglutethimide | Drug Info | [54] | |||
Anastrozole | Drug Info | [55], [56] | |||
ANDROSTENEDIONE | Drug Info | [57] | |||
ANDROSTENEDONE | Drug Info | [58] | |||
APIGENIN | Drug Info | [32] | |||
Benzyl-biphenyl-4-ylmethyl-imidazol-1-yl-amine | Drug Info | [29] | |||
BGS-649 | Drug Info | [59] | |||
BIOCHANIN | Drug Info | [32] | |||
Broussoflavonol F | Drug Info | [28] | |||
CGS-18320B | Drug Info | [32] | |||
CHRYSIN | Drug Info | [32] | |||
COUMATE | Drug Info | [37] | |||
DEHYDROLEUCODIN | Drug Info | [32] | |||
Dextromethorphan+quinidine | Drug Info | [60] | |||
Docosapentaenoic acid | Drug Info | [61] | |||
Exemestane | Drug Info | [62] | |||
FADROZOLE | Drug Info | [63] | |||
FINROZOLE | Drug Info | [64], [9] | |||
FORMESTANE | Drug Info | [65] | |||
Gamma-mangostin | Drug Info | [66] | |||
GARCINONE D | Drug Info | [66] | |||
GOSSYPETIN | Drug Info | [67] | |||
Isogemichalcone C | Drug Info | [28] | |||
ISOLICOFLAVONOL | Drug Info | [28] | |||
Letrozole | Drug Info | [62] | |||
LIAROZOLE | Drug Info | [32] | |||
LIQUIRTIGENIN | Drug Info | [67] | |||
LUDARTIN | Drug Info | [32] | |||
MDL-18962 | Drug Info | [68] | |||
MINAMESTANE | Drug Info | [69], [9] | |||
MONODICTYOCHROMONE B | Drug Info | [70] | |||
MORACHALCONE A | Drug Info | [28] | |||
MR-16089 | Drug Info | [32] | |||
MR-20492 | Drug Info | [32] | |||
MR-20494 | Drug Info | [32] | |||
MR-20496 | Drug Info | [71] | |||
MR-20814 | Drug Info | [71] | |||
N-(2-benzyloxy-4-nitrophenyl)methanesulfonamide | Drug Info | [72] | |||
N-(2-hexyloxy-4-nitrophenyl)methanesulfonamide | Drug Info | [73] | |||
N-(2-nonyloxy-4-nitrophenyl)methanesulfonamide | Drug Info | [73] | |||
N-(2-Propyloxy-4-nitrophenyl)methanesulfonamide | Drug Info | [73] | |||
N-[2-(4'-Nitrophenyl)ethyl]-imidazole | Drug Info | [32] | |||
NARINGENIN | Drug Info | [32] | |||
NKS-01 | Drug Info | [74], [9] | |||
NSC-122427 | Drug Info | [75] | |||
NSC-12999 | Drug Info | [30] | |||
NSC-131736 | Drug Info | [30] | |||
NSC-19028 | Drug Info | [32] | |||
NSC-289311 | Drug Info | [30] | |||
NSC-356483 | Drug Info | [30] | |||
NSC-356781 | Drug Info | [30] | |||
NSC-368272 | Drug Info | [30] | |||
NSC-368280 | Drug Info | [30] | |||
NSC-369087 | Drug Info | [30] | |||
NSC-613604 | Drug Info | [75] | |||
NSC-625409 | Drug Info | [30] | |||
NSC-666292 | Drug Info | [30] | |||
NSC-683634 | Drug Info | [30] | |||
NSC-75308 | Drug Info | [30] | |||
NSC-93358 | Drug Info | [75] | |||
NSC-94258 | Drug Info | [32] | |||
NSC-94891 | Drug Info | [75] | |||
Rogletimide | Drug Info | [76] | |||
Testolactone | Drug Info | [55], [77] | |||
VOROZOLE | Drug Info | [78] | |||
YM-511 | Drug Info | [79] | |||
Modulator | Atamestane-plus- Toremifene | Drug Info | [80] | ||
Org-33201 | Drug Info | ||||
Pathways | |||||
BioCyc Pathway | Superpathway of steroid hormone biosynthesis | ||||
Estradiol biosynthesis II | |||||
Estradiol biosynthesis I | |||||
KEGG Pathway | Steroid hormone biosynthesis | ||||
Metabolic pathways | |||||
Ovarian steroidogenesis | |||||
NetPath Pathway | FSH Signaling Pathway | ||||
PANTHER Pathway | Androgen/estrogene/progesterone biosynthesis | ||||
PathWhiz Pathway | Androgen and Estrogen Metabolism | ||||
Reactome | Endogenous sterols | ||||
WikiPathways | Metapathway biotransformation | ||||
Tryptophan metabolism | |||||
Oxidation by Cytochrome P450 | |||||
Ovarian Infertility Genes | |||||
Metabolism of steroid hormones and vitamin D | |||||
FSH signaling pathway | |||||
Integrated Breast Cancer Pathway | |||||
Phase 1 - Functionalization of compounds | |||||
References | |||||
REF 1 | Breakdown of Th cell immune responses and steroidogenic CYP11A1 expression in CD4+ T cells in a murine model implanted with B16 melanoma. Cell Immunol. 2000 Nov 25;206(1):7-15. | ||||
REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7054). | ||||
REF 3 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5137). | ||||
REF 4 | New drugs in development for the treatment of endometriosis. Expert Opin Investig Drugs. 2008 Aug;17(8):1187-202. | ||||
REF 5 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
REF 6 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7073). | ||||
REF 7 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8311). | ||||
REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000824) | ||||
REF 9 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 10 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5209). | ||||
REF 11 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7303). | ||||
REF 12 | ClinicalTrials.gov (NCT00044291) Phase III Study of Atamestane Plus Toremifene Versus Letrozole in Advanced Breast Cancer. U.S. National Institutes of Health. | ||||
REF 13 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5210). | ||||
REF 14 | ClinicalTrials.gov (NCT00282724) Efficacy and Safety of Two Doses of Liarozole vs. Placebo for the Treatment of Lamellar Ichthyosis. U.S. National Institutes of Health. | ||||
REF 15 | ClinicalTrials.gov (NCT01190475) BGS649 Monotherapy in Moderate to Severe Endometriosis Patients. U.S. National Institutes of Health. | ||||
REF 16 | Irosustat: a first-generation steroid sulfatase inhibitor in breast cancer. Expert Rev Anticancer Ther. 2011 Feb;11(2):179-83. | ||||
REF 17 | Dextromethorphan/quinidine: AVP 923, dextromethorphan/cytochrome P450-2D6 inhibitor, quinidine/dextromethorphan. Drugs R D. 2005;6(3):174-7. | ||||
REF 18 | ClinicalTrials.gov (NCT01091077) A Pilot Study of the Grapefruit Flavonoid Naringenin for HCV Infection. U.S. National Institutes of Health. | ||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000733) | ||||
REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010074) | ||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003076) | ||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002428) | ||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002721) | ||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002545) | ||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001207) | ||||
REF 26 | J Med Chem. 2007 Jun 14;50(12):2799-806. Epub 2007 May 19.Synthesis and biological evaluation of (+/-)-abyssinone II and its analogues as aromatase inhibitors for chemoprevention of breast cancer. | ||||
REF 27 | Bioorg Med Chem. 2008 Feb 1;16(3):1474-80. Epub 2007 Oct 22.New 7,8-benzoflavanones as potent aromatase inhibitors: synthesis and biological evaluation. | ||||
REF 28 | J Nat Prod. 2001 Oct;64(10):1286-93.Aromatase inhibitors from Broussonetia papyrifera. | ||||
REF 29 | Bioorg Med Chem. 2008 Sep 15;16(18):8349-58. Epub 2008 Aug 26.CYP19 (aromatase): exploring the scaffold flexibility for novel selective inhibitors. | ||||
REF 30 | J Med Chem. 2009 Jan 8;52(1):143-50.Fast three dimensional pharmacophore virtual screening of new potent non-steroid aromatase inhibitors. | ||||
REF 31 | Novel highly potent and selective nonsteroidal aromatase inhibitors: synthesis, biological evaluation and structure-activity relationships investigation. J Med Chem. 2010 Jul 22;53(14):5347-51. doi: 10.1021/jm100319h. | ||||
REF 32 | Bioorg Med Chem Lett. 2010 May 15;20(10):3050-64. Epub 2010 Apr 8.Pharmacophore modeling strategies for the development of novel nonsteroidal inhibitors of human aromatase (CYP19). | ||||
REF 33 | J Med Chem. 2005 Oct 20;48(21):6632-42.Heteroaryl-substituted naphthalenes and structurally modified derivatives: selective inhibitors of CYP11B2 for the treatment of congestive heart failure and myocardial fibrosis. | ||||
REF 34 | Design, synthesis, and biological evaluation of resveratrol analogues as aromatase and quinone reductase 2 inhibitors for chemoprevention of cancer. Bioorg Med Chem. 2010 Jul 15;18(14):5352-66. doi: 10.1016/j.bmc.2010.05.042. Epub 2010 May 24. | ||||
REF 35 | J Med Chem. 1991 Feb;34(2):725-36.Fadrozole hydrochloride: a potent, selective, nonsteroidal inhibitor of aromatase for the treatment of estrogen-dependent disease. | ||||
REF 36 | Bioorg Med Chem Lett. 2004 Oct 18;14(20):5215-8.Synthesis and evaluation of 4-triazolylflavans as new aromatase inhibitors. | ||||
REF 37 | J Med Chem. 2010 Mar 11;53(5):2155-70.Highly potent first examples of dual aromatase-steroid sulfatase inhibitors based on a biphenyl template. | ||||
REF 38 | A new class of nonsteroidal aromatase inhibitors: design and synthesis of chromone and xanthone derivatives and inhibition of the P450 enzymes aromatase and 17 alpha-hydroxylase/C17,20-lyase. J Med Chem. 2001 Mar 1;44(5):672-80. | ||||
REF 39 | Bioorg Med Chem Lett. 1999 Feb 8;9(3):333-6.New selective nonsteroidal aromatase inhibitors: synthesis and inhibitory activity of 2,3 or 5-(alpha-azolylbenzyl)-1H-indoles. | ||||
REF 40 | Bioorg Med Chem. 2005 Jun 2;13(12):4063-70. Epub 2005 Apr 25.Synthesis and characterization of azole isoflavone inhibitors of aromatase. | ||||
REF 41 | Bioorg Med Chem Lett. 2002 Apr 8;12(7):1059-61.New aromatase inhibitors. Synthesis and inhibitory activity of pyridinyl-substituted flavanone derivatives. | ||||
REF 42 | J Med Chem. 2006 Apr 6;49(7):2222-31.Synthesis and evaluation of heteroaryl-substituted dihydronaphthalenes and indenes: potent and selective inhibitors of aldosterone synthase (CYP11B2) for the treatment of congestive heart failure and myocardial fibrosis. | ||||
REF 43 | J Med Chem. 2005 Mar 10;48(5):1563-75.Synthesis and evaluation of (pyridylmethylene)tetrahydronaphthalenes/-indanes and structurally modified derivatives: potent and selective inhibitors of aldosterone synthase. | ||||
REF 44 | J Med Chem. 1986 Apr;29(4):520-3.Synthesis and biochemical evaluation of analogues of aminoglutethimide based on phenylpyrrolidine-2,5-dione. | ||||
REF 45 | J Med Chem. 1986 Aug;29(8):1362-9.Aromatase inhibitors. Synthesis and evaluation of mammary tumor inhibiting activity of 3-alkylated 3-(4-aminophenyl)piperidine-2,6-diones. | ||||
REF 46 | J Med Chem. 2008 Dec 25;51(24):8077-87.In vivo active aldosterone synthase inhibitors with improved selectivity: lead optimization providing a series of pyridine substituted 3,4-dihydro-1H-quinolin-2-one derivatives. | ||||
REF 47 | J Med Chem. 2006 Jul 27;49(15):4777-80.Lead optimization providing a series of flavone derivatives as potent nonsteroidal inhibitors of the cytochrome P450 aromatase enzyme. | ||||
REF 48 | J Med Chem. 2010 Aug 12;53(15):5749-58.Replacement of imidazolyl by pyridyl in biphenylmethylenes results in selective CYP17 and dual CYP17/CYP11B1 inhibitors for the treatment of prostate cancer. | ||||
REF 49 | J Med Chem. 1993 May 14;36(10):1393-400.Aromatase inhibitors: synthesis, biological activity, and binding mode of azole-type compounds. | ||||
REF 50 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
REF 51 | J Med Chem. 2005 Mar 24;48(6):1796-805.Synthesis and evaluation of imidazolylmethylenetetrahydronaphthalenes and imidazolylmethyleneindanes: potent inhibitors of aldosterone synthase. | ||||
REF 52 | J Med Chem. 2004 Dec 30;47(27):6792-803.Design, synthesis, and 3D QSAR of novel potent and selective aromatase inhibitors. | ||||
REF 53 | Aromatase inhibitors and their use in the adjuvant setting. Recent Results Cancer Res. 1998;152:277-84. | ||||
REF 54 | Aminoglutethimide-induced protein free radical formation on myeloperoxidase: a potential mechanism of agranulocytosis. Chem Res Toxicol. 2007 Jul;20(7):1038-45. Epub 2007 Jun 30. | ||||
REF 55 | Aromatase inhibitors for male infertility. J Urol. 2002 Feb;167(2 Pt 1):624-9. | ||||
REF 56 | Effective aromatase inhibition by anastrozole in a patient with gonadotropin-independent precocious puberty in McCune-Albright syndrome. J Pediatr Endocrinol Metab. 2002;15 Suppl 3:945-8. | ||||
REF 57 | J Med Chem. 1994 Jul 8;37(14):2198-205.Synthesis of androst-5-en-7-ones and androsta-3,5-dien-7-ones and their related 7-deoxy analogs as conformational and catalytic probes for the active site of aromatase. | ||||
REF 58 | J Med Chem. 1989 Mar;32(3):651-8.Effects of steroid D-ring modification on suicide inactivation and competitive inhibition of aromatase by analogues of androsta-1,4-diene-3,17-dione. | ||||
REF 59 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032111) | ||||
REF 60 | Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26. | ||||
REF 61 | J Nat Prod. 2006 Apr;69(4):700-3.Interference by naturally occurring fatty acids in a noncellular enzyme-based aromatase bioassay. | ||||
REF 62 | Aromatase inhibitors--theoretical concept and present experiences in the treatment of endometriosis. Zentralbl Gynakol. 2003 Jul-Aug;125(7-8):247-51. | ||||
REF 63 | J Med Chem. 2005 Nov 17;48(23):7282-9.Enantioselective nonsteroidal aromatase inhibitors identified through a multidisciplinary medicinal chemistry approach. | ||||
REF 64 | Pharmacokinetics of finrozole (MPV-2213ad), a novel selective aromatase inhibitor, in healthy men. Br J Clin Pharmacol. 2001 Dec;52(6):702-4. | ||||
REF 65 | J Nat Prod. 2010 Feb 26;73(2):284-98.The taiwaniaquinoids: a review. | ||||
REF 66 | J Nat Prod. 2008 Jul;71(7):1161-6. Epub 2008 Jun 18.Xanthones from the botanical dietary supplement mangosteen (Garcinia mangostana) with aromatase inhibitory activity. | ||||
REF 67 | Bioorg Med Chem. 2008 Sep 15;16(18):8466-70. Epub 2008 Aug 19.Screening of herbal constituents for aromatase inhibitory activity. | ||||
REF 68 | J Med Chem. 1997 Sep 26;40(20):3263-70.6 beta-Propynyl-substituted steroids: mechanism-based enzyme-activated irreversible inhibitors of aromatase. | ||||
REF 69 | High-performance liquid chromatographic determination of FCE 24928, a new aromatase inhibitor, in human plasma. J Chromatogr A. 1994 Feb 4;660(1-2):293-8. | ||||
REF 70 | J Nat Prod. 2008 Dec 1;71(11):1793-1799. Epub 2008 Oct 21.Monodictyochromes A and B, Dimeric Xanthone Derivatives from the Marine Algicolous Fungus Monodictys putredinis. | ||||
REF 71 | Bioorg Med Chem Lett. 1998 May 5;8(9):1041-4.Design and synthesis of a new type of non steroidal human aromatase inhibitors. | ||||
REF 72 | J Med Chem. 2007 Apr 5;50(7):1635-44. Epub 2007 Feb 22.Synthesis and biological evaluation of selective aromatase expression regulators in breast cancer cells. | ||||
REF 73 | J Med Chem. 2006 Feb 23;49(4):1413-9.Novel sulfonanilide analogues suppress aromatase expression and activity in breast cancer cells independent of COX-2 inhibition. | ||||
REF 74 | Effects of aromatase inhibitors on the pathobiology of the human breast, endometrial and ovarian carcinoma. Endocr Relat Cancer. 1999 Jun;6(2):197-204. | ||||
REF 75 | Eur J Med Chem. 2009 Oct;44(10):4121-7. Epub 2009 May 19.An efficient steroid pharmacophore-based strategy to identify new aromatase inhibitors. | ||||
REF 76 | J Med Chem. 1987 Sep;30(9):1550-4.Analogues of 3-ethyl-3-(4-pyridyl)piperidine-2,6-dione as selective inhibitors of aromatase: derivatives with variable 1-alkyl and 3-alkyl substituents. | ||||
REF 77 | Testosterone versus testosterone and testolactone in treating reproductive and sexual dysfunction in men with epilepsy and hypogonadism. Neurology. 1998 Mar;50(3):782-4. | ||||
REF 78 | J Med Chem. 2008 Jul 24;51(14):4226-38. Epub 2008 Jul 1.Chiral aromatase and dual aromatase-steroid sulfatase inhibitors from the letrozole template: synthesis, absolute configuration, and in vitro activity. | ||||
REF 79 | J Med Chem. 2003 Jul 17;46(15):3193-6.First dual aromatase-steroid sulfatase inhibitors. | ||||
REF 80 | J Steroid Biochem Mol Biol. 2008 Jan;108(1-2):1-7. Epub 2007 Sep 7.Toremifene-atamestane; alone or in combination: predictions from the preclinical intratumoral aromatase model. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.