Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T76685
|
||||
Former ID |
TTDS00334
|
||||
Target Name |
Cannabinoid receptor 1
|
||||
Gene Name |
CNR1
|
||||
Synonyms |
CANN6; CB-R; CB1; Cannabinoid CB1 receptor; CNR1
|
||||
Target Type |
Successful
|
||||
Disease | Anorexia [ICD9: 307.1; ICD10: F50.0-F50.1] | ||||
Central nervous system disease [ICD10: G00-G99] | |||||
Cerebrovascular ischaemia [ICD9: 434.91; ICD10: I61-I63] | |||||
Chemotherapy-induced nausea [ICD9: 787, 787.0; ICD10: R11] | |||||
Diabetes; Obesity [ICD9: 250, 278; ICD10: E08-E13, E66] | |||||
Drug abuse [ICD9: 303-304; ICD10: F10-F19] | |||||
Endocrine disease [ICD10: E00-E35] | |||||
Hypertension; Diabetes; Obesity [ICD9: 250, 278, 401; ICD10: E08-E13, E66, I10-I16] | |||||
Ischemia [ICD9: 459.89; ICD10: I99.8] | |||||
Insomnia [ICD9: 307.41, 307.42, 327.0, 780.51, 780.52; ICD10: F51.0, G47.0] | |||||
Lipid metabolism disorder [ICD10: E75-E78] | |||||
Metabolic disorders [ICD9: 270-279; ICD10: E70-E89] | |||||
Nicotine dependence; Obesity [ICD9: 278, 305.1; ICD10: E66, F17] | |||||
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
Obesity [ICD9: 278; ICD10: E66] | |||||
Obesity; Metabolic disorders [ICD9: 270-279, 278; ICD10: E66, E70-E89] | |||||
Obesity; Diabetes [ICD9: 250, 278; ICD10: E08-E13, E66] | |||||
Ovarian cancer [ICD9: 183; ICD10: C56] | |||||
Psychotic disorders [ICD9: 290-299; ICD10: F20-F29] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Postherpetic neuralgia [ICD9: 53.19; ICD10: B02.2, G44.847, G53.0] | |||||
Schizophrenia [ICD9: 295; ICD10: F20] | |||||
Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
Tobacco dependence [ICD9: 305.1; ICD10: F17] | |||||
Function |
Involved in cannabinoid-induced cns effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T76685
|
||||
UniProt ID | |||||
Sequence |
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL |
||||
Drugs and Mode of Action | |||||
Drug(s) | Marinol | Drug Info | Approved | Anorexia | [538510] |
NABILONE | Drug Info | Approved | Insomnia | [551871] | |
SR141716A | Drug Info | Approved | Obesity | [546366], [551871] | |
TETRAHYDROLIPSTATIN | Drug Info | Approved | Obesity | [545361], [551871] | |
Dronabinol oral solution | Drug Info | Phase 2/3 | Chemotherapy-induced nausea | [551036] | |
GW-42004 | Drug Info | Phase 2 | Lipid metabolism disorder | [549419] | |
SR-147778 | Drug Info | Phase 2 | Obesity | [521745] | |
Tebipenem | Drug Info | Phase 2 | Nicotine dependence; Obesity | [536122] | |
TM38837 | Drug Info | Phase 1 | Obesity; Metabolic disorders | [543260], [550186] | |
V-24343 | Drug Info | Phase 1 | Type 2 diabetes | [522402] | |
ZY01 | Drug Info | Phase 1 | Obesity; Diabetes | [551790] | |
CB1 antagonist, Bayer | Drug Info | Preclinical | Obesity | [536122] | |
JD-5037 | Drug Info | Preclinical | Obesity; Diabetes | [551059] | |
Rimonabant | Drug Info | Withdrawn from market | Obesity | [537145], [542474] | |
Rimonbant | Drug Info | Withdrawn from market | Obesity | [536710] | |
CP-945598 | Drug Info | Discontinued in Phase 3 | Obesity | [536122] | |
Taranabant | Drug Info | Discontinued in Phase 3 | Obesity | [537068] | |
AVE1625 | Drug Info | Discontinued in Phase 2 | Psychotic disorders | [547945] | |
AZD1940 | Drug Info | Discontinued in Phase 2 | Pain | [548585] | |
AZD2207 | Drug Info | Discontinued in Phase 2 | Diabetes; Obesity | [548462] | |
KDS-2000 | Drug Info | Discontinued in Phase 2 | Postherpetic neuralgia | [536374] | |
KN-38-7271 | Drug Info | Discontinued in Phase 2 | Ischemia | [547265] | |
SLV319 | Drug Info | Discontinued in Phase 2 | Obesity | [547594] | |
AZD1175 | Drug Info | Discontinued in Phase 1 | Hypertension; Diabetes; Obesity | [548277] | |
AZD1704 | Drug Info | Discontinued in Phase 1 | Pain | [548792] | |
CBD cannabis derivative | Drug Info | Discontinued in Phase 1 | Schizophrenia | [536463] | |
PF-514273 | Drug Info | Discontinued in Phase 1 | Obesity | [548445] | |
TAK-937 | Drug Info | Discontinued in Phase 1 | Cerebrovascular ischaemia | [548963] | |
Dianicline+rimonabant | Drug Info | Terminated | Tobacco dependence | [548622] | |
WIN-55212-2 | Drug Info | Terminated | Discovery agent | [542353], [545702] | |
Inhibitor | (1R,2R)-N-Arachidonoylcyclopropanolamide | Drug Info | [530070] | ||
(1R,2R)-N-Oleoylcyclopropanolamide | Drug Info | [530070] | |||
(1R,2S)-N-Arachidonoylcyclopropanolamide | Drug Info | [530070] | |||
(1R,2S)-N-Oleoylcyclopropanolamide | Drug Info | [530070] | |||
(1S,2R)-N-Oleoylcyclopropanolamide | Drug Info | [530070] | |||
(1S,2S)-N-Arachidonoylcyclopropanolamide | Drug Info | [530070] | |||
(1S,2S)-N-Oleoylcyclopropanolamide | Drug Info | [530070] | |||
(2R)-N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
(2R)-N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
(2S)-N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
(4-benzhydrylpiperazin-1-yl)(cyclohexyl)methanone | Drug Info | [530617] | |||
(E)-N-(3,5-dimethoxyphenethyl)undec-2-enamide | Drug Info | [527788] | |||
(E)-N-(4-methoxyphenethyl)undec-2-enamide | Drug Info | [527788] | |||
(E)-N-(4-methoxyphenyl)undec-2-enamide | Drug Info | [527788] | |||
1,3,5-triphenylimidazolidine-2,4-dione | Drug Info | [527995] | |||
1,3,5-tris(4-chlorophenyl)imidazolidine-2,4-dione | Drug Info | [527995] | |||
1,4-dihydroindeno[1,2-c]-pyrazole | Drug Info | [527858] | |||
1,5-bis(4-chlorophenyl)-1H-1,2,3-triazole | Drug Info | [529882] | |||
1-(2-morpholinoethyl)-1H-indol-3-yl acetate | Drug Info | [528907] | |||
1-(4-CHLOROPHENYL)-2-(2,4-DICHLOROPHENYL)-5-(METHYLSULFINYL)-N-(PIPERIDIN-1-YL)-1H-IMIDAZOLE-4-CARBOXAMIDE (ENANTIOMERIC MIX) | Drug Info | [530827] | |||
1-(bis(4-bromophenyl)methyl)-3-phenylurea | Drug Info | [527861] | |||
1-(bis(4-chlorophenyl)methyl)-3-phenylurea | Drug Info | [527861] | |||
1-[bis(4-bromophenyl)methyl]-3-phenylthiourea | Drug Info | [527861] | |||
1-[bis(4-chlorophenyl)methyl]-3-(4-chlorophenyl)- | Drug Info | [527861] | |||
1-[bis(4-chlorophenyl)methyl]-3-phenylthiourea | Drug Info | [527861] | |||
1-[bis(4-iodophenyl)methyl]-3-(4-bromophenyl)urea | Drug Info | [527861] | |||
2'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol | Drug Info | [528844] | |||
2-Benzylbenzo[f]chromen-3-one | Drug Info | [530009] | |||
3'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol | Drug Info | [528844] | |||
3,4-diarylpyrazoline derivative | Drug Info | [527721] | |||
3-Benzyl-5-isopropyl-8-methylchromen-2-one | Drug Info | [530009] | |||
3-Benzyl-5-methoxy-7-methylchromen-2-one | Drug Info | [530009] | |||
3-Benzyl-5-methoxychromen-2-one | Drug Info | [530009] | |||
4'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol | Drug Info | [528844] | |||
4-(1,1-dimethyl-heptyl)-2'-methoxy-biphenyl-2-ol | Drug Info | [528844] | |||
4-(1,1-dimethyl-heptyl)-3'-methoxy-biphenyl-2-ol | Drug Info | [528844] | |||
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
4-benzhydryl-N-butylpiperazine-1-carboxamide | Drug Info | [530617] | |||
4-benzhydryl-N-cyclohexylpiperazine-1-carboxamide | Drug Info | [530617] | |||
4-cyanophenyl ethyl dodecylphosphonate | Drug Info | [529659] | |||
5-(1,1-dimethyl-heptyl)-2-pyridin-3-yl-phenol | Drug Info | [528844] | |||
5-Biphenyl-4-ylmethyl-2-isobutyl-2H-tetrazole | Drug Info | [529434] | |||
5-Methoxy-3-(2-methoxybenzyl)-2H-chromen-2-one | Drug Info | [530009] | |||
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-((R)-1-HYDROXYETHYL)-1,2,2-TRIMETHYL-1,2,3,4-TETRAHYDRO-1,8-NAPHTHYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-(1-HYDROXY-2-METHYLPROPAN-2-YL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-(HYDROXYMETHYL)-1,2,2-TRIMETHYL-1,2,3,4-TETRAHYDRO-1,8-NAPHTHYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
A-796260 | Drug Info | [530525] | |||
AM-1241 | Drug Info | [530525] | |||
AM-1710 | Drug Info | [529170] | |||
AM-1714 | Drug Info | [529170] | |||
AM-1715 | Drug Info | [529170] | |||
AM-281 | Drug Info | [530009] | |||
AM-404 | Drug Info | [534262] | |||
AM-411 | Drug Info | [531004] | |||
AM-4768 | Drug Info | [529170] | |||
AM-630 | Drug Info | [529106] | |||
Chlorphrifos oxon | Drug Info | [529659] | |||
Cis-N-oleoylcyclopropanolamide | Drug Info | [530070] | |||
CP-4497 | Drug Info | [531027] | |||
CP-55940 | Drug Info | [530009] | |||
DELTA 8-TETRAHYDROCANNOBINOL | Drug Info | [529727] | |||
Dodecane-1-sulfonyl fluoride | Drug Info | [529659] | |||
Isopropyl 4-nitrophenyl dodecylphosphonate | Drug Info | [529659] | |||
Isopropyl dodecylfluorophosphonate | Drug Info | [529440] | |||
JWH-120 | Drug Info | [529920] | |||
JWH-133 | Drug Info | [531214] | |||
JWH-145 | Drug Info | [528355] | |||
JWH-146 | Drug Info | [528355] | |||
JWH-147 | Drug Info | [528355] | |||
JWH-150 | Drug Info | [528355] | |||
JWH-156 | Drug Info | [528355] | |||
JWH-229 | Drug Info | [529920] | |||
JWH-243 | Drug Info | [528355] | |||
JWH-244 | Drug Info | [528355] | |||
JWH-245 | Drug Info | [528355] | |||
JWH-246 | Drug Info | [528355] | |||
JWH-268 | Drug Info | [529920] | |||
JWH-292 | Drug Info | [528355] | |||
JWH-293 | Drug Info | [528355] | |||
JWH-297 | Drug Info | [529084] | |||
JWH-307 | Drug Info | [528355] | |||
JWH-308 | Drug Info | [528355] | |||
JWH-309 | Drug Info | [528355] | |||
JWH-324 | Drug Info | [531027] | |||
JWH-325 | Drug Info | [529084] | |||
JWH-337 | Drug Info | [529084] | |||
JWH-342 | Drug Info | [529084] | |||
JWH-344 | Drug Info | [529084] | |||
JWH-345 | Drug Info | [529084] | |||
JWH-346 | Drug Info | [528355] | |||
JWH-347 | Drug Info | [528355] | |||
JWH-348 | Drug Info | [528355] | |||
JWH-363 | Drug Info | [528355] | |||
JWH-364 | Drug Info | [528355] | |||
JWH-365 | Drug Info | [528355] | |||
JWH-366 | Drug Info | [528355] | |||
JWH-367 | Drug Info | [528355] | |||
JWH-368 | Drug Info | [528355] | |||
JWH-369 | Drug Info | [528355] | |||
JWH-370 | Drug Info | [528355] | |||
JWH-371 | Drug Info | [528355] | |||
JWH-372 | Drug Info | [528355] | |||
JWH-373 | Drug Info | [528355] | |||
JWH-385 | Drug Info | [529084] | |||
JWH-392 | Drug Info | [529084] | |||
JWH-401 | Drug Info | [529084] | |||
JWH-402 | Drug Info | [529084] | |||
JWH-403 | Drug Info | [529084] | |||
JWH-404 | Drug Info | [529084] | |||
JWH-405 | Drug Info | [529084] | |||
JWH-406 | Drug Info | [529084] | |||
JWH-407 | Drug Info | [529084] | |||
JWH-440 | Drug Info | [531027] | |||
JWH-442 | Drug Info | [531027] | |||
KM-233 | Drug Info | [529515] | |||
KM-233-M | Drug Info | [529515] | |||
Methyl icosylphosphonofluoridate | Drug Info | [529659] | |||
N-(1-adamantyl)-N'-propylsulfamide | Drug Info | [530389] | |||
N-(1H-indazol-5-yl)icosa-5,8,11,14-tetraenamide | Drug Info | [529838] | |||
N-(2,4-dimethoxyphenethyl)docos-13-enamide | Drug Info | [527788] | |||
N-(2,4-dimethoxyphenethyl)oleamide | Drug Info | [527788] | |||
N-(2-adamantyl)-N'-propylsulfamide | Drug Info | [530389] | |||
N-(2-chloroethyl)icosa-5,8,11,14-tetraenamide | Drug Info | [529106] | |||
N-(3,3-Diphenyl)propyl-2,2-diphenylacetamide | Drug Info | [529563] | |||
N-(3,3-Diphenyl)propyl-2-phenylacetamide | Drug Info | [529563] | |||
N-(3,5-dimethoxyphenethyl)docos-13-enamide | Drug Info | [527788] | |||
N-(3,5-dimethoxyphenethyl)oleamide | Drug Info | [527788] | |||
N-(3-Phenyl)propyl-2,2-diphenylacetamide | Drug Info | [529563] | |||
N-(3-Phenyl)propyl-2-(4-bromophenylacetamide) | Drug Info | [529563] | |||
N-(4-hydroxybenzyl)icosa-5,8,11,14-tetraenamide | Drug Info | [529838] | |||
N-(4-methoxybenzyl)oleamide | Drug Info | [527788] | |||
N-(4-methoxyphenethyl)oleamide | Drug Info | [527788] | |||
N-(4-methoxyphenyl)oleamide | Drug Info | [527788] | |||
N-(4-morpholinophenyl)docos-13-enamide | Drug Info | [527788] | |||
N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYACETAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-3-HYDROXY-2,2-DIMETHYLPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-3-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXY-2-METHYLPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
N-(7-(2-CHLOROPHENYL)-6-(4-CHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYACETAMIDE (ENANTIOMERIC MIX) | Drug Info | [530929] | |||
N-(cis-9-cis-12-octadecadienyl)sulfamide | Drug Info | [530389] | |||
N-arachidonoyl-N-(2-hydroxyethyl)hydroxylamine | Drug Info | [528112] | |||
N-arachidonoyl-O-(2-hydroxyethyl)hydroxylamine | Drug Info | [528112] | |||
N-ethyl-5,6-dip-tolylpyrazine-2-carboxamide | Drug Info | [528851] | |||
N-isopentyl-5,6-dip-tolylpyrazine-2-carboxamide | Drug Info | [528851] | |||
N-isopropyl-5,6-dip-tolylpyrazine-2-carboxamide | Drug Info | [528851] | |||
N-methyl-5,6-dip-tolylpyrazine-2-carboxamide | Drug Info | [528851] | |||
N-octadecyl-N'-propylsulfamide | Drug Info | [530389] | |||
N-phenyl-5,6-dip-tolylpyrazine-2-carboxamide | Drug Info | [528851] | |||
N-[6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-YL]-4,4,4-TRIFLUORO-3-HYDROXYBUTANAMIDE (DIASTEREOMERIC MIX) | Drug Info | [530871] | |||
NABILONE | Drug Info | [531196] | |||
NAPHTHYRIDINONE | Drug Info | [530929] | |||
O-arachidonoyl-N-(2-hydroxyethyl)hydroxylamine | Drug Info | [528112] | |||
Octane-1-sulfonyl fluoride | Drug Info | [529659] | |||
OLEOYLETHANOLAMIDE | Drug Info | [530070] | |||
PARAOXON | Drug Info | [529659] | |||
PRAVADOLINE | Drug Info | [551296] | |||
Rac-cis-N-arachidonoylcyclopropanolamide | Drug Info | [530070] | |||
Rac-trans-N-oleoylcyclopropanolamide | Drug Info | [530070] | |||
SCH-356036 | Drug Info | [530597] | |||
SEMIPLENAMIDE A | Drug Info | [526859] | |||
SEMIPLENAMIDE B | Drug Info | [526859] | |||
Semiplenamide G | Drug Info | [526859] | |||
TETRAHYDROLIPSTATIN | Drug Info | [529733] | |||
VER-156084 | Drug Info | [530200] | |||
VER-156085 | Drug Info | [530200] | |||
WIN-55212-2 | Drug Info | [530009] | |||
{[(9Z)-octadec-9-en-1-yl]sulfamoyl}amine | Drug Info | [530389] | |||
Agonist | ACEA | Drug Info | [536731] | ||
Anandamide | Drug Info | [537577] | |||
arachidonyl-2-chloroethylamide | Drug Info | [525498] | |||
arachidonylcyclopropylamide | Drug Info | [525498] | |||
AZ-599 | Drug Info | [543877] | |||
AZD1940 | Drug Info | [550288] | |||
cannabinol | Drug Info | [534216] | |||
Delta(9)-tetrahydrocannabinol | Drug Info | [537149] | |||
Dianicline+rimonabant | Drug Info | [537145] | |||
Dibenzothiazepines | Drug Info | [543877] | |||
HU210 | Drug Info | [535946] | |||
JD-5037 | Drug Info | [551059] | |||
KDS-2000 | Drug Info | [536374] | |||
Marinol | Drug Info | [537087] | |||
MK-5596 | Drug Info | [543877] | |||
O-1812 | Drug Info | [525966] | |||
[3H]CP55940 | Drug Info | [534130] | |||
[3H]HU-243 | Drug Info | [526736] | |||
[3H]WIN55212-2 | Drug Info | [534535] | |||
Antagonist | AM251 | Drug Info | [535887] | ||
AVE1625 | Drug Info | [549823] | |||
AZD1175 | Drug Info | [550288] | |||
AZD1704 | Drug Info | [550288] | |||
AZD2207 | Drug Info | [550288], [551589] | |||
BMS-812204 | Drug Info | [543877] | |||
Cannabinoid 1 antagonists | Drug Info | [543877] | |||
CB1 antagonist, Bayer | Drug Info | [536122] | |||
CB1 antagonists | Drug Info | [543877] | |||
CB1 antagonists | Drug Info | [543877] | |||
CBD cannabis derivative | Drug Info | [536463] | |||
compound 70 | Drug Info | [533285] | |||
CP-945598 | Drug Info | [549974] | |||
CXB-029 | Drug Info | [543877] | |||
LY320135 | Drug Info | [534541] | |||
Methanandamide | Drug Info | [537268] | |||
Rimonabant | Drug Info | [536549], [536956], [537149] | |||
Rimonbant | Drug Info | [536710] | |||
SLV319 | Drug Info | [532030] | |||
SR141716A | Drug Info | [535198], [535946] | |||
Taranabant | Drug Info | [537149] | |||
Tebipenem | Drug Info | [536122] | |||
TM38837 | Drug Info | [550186] | |||
V-24343 | Drug Info | [529987] | |||
ZY01 | Drug Info | [551790] | |||
[123I]AM251 | Drug Info | [534489] | |||
Modulator | Dronabinol oral solution | Drug Info | [1572591] | ||
GW-42004 | Drug Info | ||||
KN-38-7271 | Drug Info | ||||
PF-514273 | Drug Info | [532853] | |||
SR-147778 | Drug Info | ||||
TAK-937 | Drug Info | [531715] | |||
Modulator (allosteric modulator) | Org27569 | Drug Info | [531899] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Rap1 signaling pathway | ||||
Neuroactive ligand-receptor interaction | |||||
Retrograde endocannabinoid signaling | |||||
PANTHER Pathway | Endogenous cannabinoid signaling | ||||
Pathway Interaction Database | N-cadherin signaling events | ||||
Reactome | Class A/1 (Rhodopsin-like receptors) | ||||
G alpha (i) signalling events | |||||
WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
Small Ligand GPCRs | |||||
BDNF signaling pathway | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
GPCRs, Other | |||||
References | |||||
Ref 521745 | ClinicalTrials.gov (NCT00239174) A Multicenter Study to Evaluate the Efficacy and Safety of of Four Doses of SR147778 in Obese Patients. U.S. National Institutes of Health. | ||||
Ref 522402 | ClinicalTrials.gov (NCT00734201) Safety and Efficacy of Low Doses of V24343 in Obese Subjects. U.S. National Institutes of Health. | ||||
Ref 536122 | Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60. | ||||
Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
Ref 537145 | Emerging drugs for the treatment of tobacco dependence. Expert Opin Emerg Drugs. 2009 Mar;14(1):23-32. | ||||
Ref 538510 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 018651. | ||||
Ref 542353 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 733). | ||||
Ref 542474 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 745). | ||||
Ref 543260 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8705). | ||||
Ref 545361 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003007) | ||||
Ref 545702 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004262) | ||||
Ref 546366 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007737) | ||||
Ref 547265 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014615) | ||||
Ref 547594 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017654) | ||||
Ref 547945 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020616) | ||||
Ref 548277 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024090) | ||||
Ref 548445 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025584) | ||||
Ref 548462 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025707) | ||||
Ref 548585 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026807) | ||||
Ref 548622 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027143) | ||||
Ref 548792 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028889) | ||||
Ref 548963 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030875) | ||||
Ref 525498 | Synthesis and characterization of potent and selective agonists of the neuronal cannabinoid receptor (CB1). J Pharmacol Exp Ther. 1999 Jun;289(3):1427-33. | ||||
Ref 525966 | Highly selective CB(1) cannabinoid receptor ligands and novel CB(1)/VR(1) vanilloid receptor "hybrid" ligands. Biochem Biophys Res Commun. 2001 Feb 23;281(2):444-51. | ||||
Ref 526859 | J Nat Prod. 2003 Oct;66(10):1364-8.Semiplenamides A-G, fatty acid amides from a Papua New Guinea collection of the marine cyanobacterium Lyngbya semiplena. | ||||
Ref 527721 | Bioorg Med Chem Lett. 2005 Nov 1;15(21):4794-8.Novel 3,4-diarylpyrazolines as potent cannabinoid CB1 receptor antagonists with lower lipophilicity. | ||||
Ref 527788 | Bioorg Med Chem Lett. 2006 Jan 1;16(1):138-41. Epub 2005 Oct 6.New metabolically stable fatty acid amide ligands of cannabinoid receptors: Synthesis and receptor affinity studies. | ||||
Ref 527858 | J Med Chem. 2005 Nov 17;48(23):7351-62.Tricyclic pyrazoles. 3. Synthesis, biological evaluation, and molecular modeling of analogues of the cannabinoid antagonist 8-chloro-1-(2',4'-dichlorophenyl)-N-piperidin-1-yl-1,4,5,6-tetrahydrobenzo[6,7]cyclohepta[1,2-c]pyrazole-3-carboxamide. | ||||
Ref 527861 | J Med Chem. 2005 Nov 17;48(23):7486-90.1-Benzhydryl-3-phenylurea and 1-benzhydryl-3-phenylthiourea derivatives: new templates among the CB1 cannabinoid receptor inverse agonists. | ||||
Ref 527995 | J Med Chem. 2006 Feb 9;49(3):872-82.Synthesis and activity of 1,3,5-triphenylimidazolidine-2,4-diones and 1,3,5-triphenyl-2-thioxoimidazolidin-4-ones: characterization of new CB1 cannabinoid receptorinverse agonists/antagonists. | ||||
Ref 528112 | J Med Chem. 2006 Apr 6;49(7):2333-8.Oxyhomologues of anandamide and related endolipids: chemoselective synthesis and biological activity. | ||||
Ref 528355 | Bioorg Med Chem Lett. 2006 Oct 15;16(20):5432-5. Epub 2006 Aug 4.1-Alkyl-2-aryl-4-(1-naphthoyl)pyrroles: new high affinity ligands for the cannabinoid CB1 and CB2 receptors. | ||||
Ref 528844 | Bioorg Med Chem Lett. 2007 Jul 1;17(13):3652-6. Epub 2007 Apr 25.Biaryl cannabinoid mimetics--synthesis and structure-activity relationship. | ||||
Ref 528851 | Bioorg Med Chem Lett. 2007 Jul 15;17(14):3978-82. Epub 2007 Apr 29.Discovery of pyrazine carboxamide CB1 antagonists: the introduction of a hydroxyl group improves the pharmaceutical properties and in vivo efficacy of the series. | ||||
Ref 528907 | Eur J Med Chem. 2008 Mar;43(3):513-39. Epub 2007 May 6.Synthesis and cannabinoid activity of 1-substituted-indole-3-oxadiazole derivatives: novel agonists for the CB1 receptor. | ||||
Ref 529084 | Bioorg Med Chem. 2008 Jan 1;16(1):322-35. Epub 2007 Sep 22.Synthesis and pharmacology of 1-deoxy analogs of CP-47,497 and CP-55,940. | ||||
Ref 529106 | Bioorg Med Chem Lett. 2007 Dec 1;17(23):6505-10. Epub 2007 Oct 1.New 1,8-naphthyridine and quinoline derivatives as CB2 selective agonists. | ||||
Ref 529170 | J Med Chem. 2007 Dec 27;50(26):6493-500. Epub 2007 Nov 27.Cannabilactones: a novel class of CB2 selective agonists with peripheral analgesic activity. | ||||
Ref 529434 | Bioorg Med Chem Lett. 2008 May 1;18(9):2820-4. Epub 2008 Apr 4.New tetrazole-based selective anandamide uptake inhibitors. | ||||
Ref 529440 | Nat Chem Biol. 2008 Jun;4(6):373-8. Epub 2008 Apr 27.Activation of the endocannabinoid system by organophosphorus nerve agents. | ||||
Ref 529515 | Bioorg Med Chem. 2008 Jul 1;16(13):6489-500. Epub 2008 May 20.Exploring the substituent effects on a novel series of C1'-dimethyl-aryl Delta8-tetrahydrocannabinol analogs. | ||||
Ref 529563 | Bioorg Med Chem. 2008 Aug 1;16(15):7510-5. Epub 2008 Jun 7.Novel sterically hindered cannabinoid CB1 receptor ligands. | ||||
Ref 529659 | Bioorg Med Chem Lett. 2008 Nov 15;18(22):5875-8. Epub 2008 Aug 6.Monoacylglycerol lipase regulates 2-arachidonoylglycerol action and arachidonic acid levels. | ||||
Ref 529727 | J Med Chem. 2008 Oct 23;51(20):6393-9. Epub 2008 Oct 1.Bornyl- and isobornyl-Delta8-tetrahydrocannabinols: a novel class of cannabinergic ligands. | ||||
Ref 529733 | J Med Chem. 2008 Nov 13;51(21):6970-9. Epub 2008 Oct 3.Tetrahydrolipstatin analogues as modulators of endocannabinoid 2-arachidonoylglycerol metabolism. | ||||
Ref 529838 | J Med Chem. 2008 Dec 25;51(24):7800-5.New analgesics synthetically derived from the paracetamol metabolite N-(4-hydroxyphenyl)-(5Z,8Z,11Z,14Z)-icosatetra-5,8,11,14-enamide. | ||||
Ref 529882 | Bioorg Med Chem Lett. 2009 Feb 1;19(3):891-3. Epub 2008 Dec 6.Synthesis and CB1 cannabinoid receptor affinity of 4-alkoxycarbonyl-1,5-diaryl-1,2,3-triazoles. | ||||
Ref 529920 | J Med Chem. 2009 Jan 22;52(2):369-78.Discovery of novel CB2 receptor ligands by a pharmacophore-based virtual screening workflow. | ||||
Ref 529987 | Cannabinoid receptor antagonists: pharmacological opportunities, clinical experience, and translational prognosis. Expert Opin Emerg Drugs. 2009 Mar;14(1):43-65. | ||||
Ref 530009 | Bioorg Med Chem. 2009 Apr 1;17(7):2842-51. Epub 2009 Feb 21.Synthesis and pharmacological evaluation of coumarin derivatives as cannabinoid receptor antagonists and inverse agonists. | ||||
Ref 530070 | J Med Chem. 2009 May 14;52(9):3001-9.Conformationally constrained fatty acid ethanolamides as cannabinoid and vanilloid receptor probes. | ||||
Ref 530200 | Bioorg Med Chem Lett. 2009 Aug 1;19(15):4241-4. Epub 2009 May 29.Fatty acid amide hydrolase inhibitors. Surprising selectivity of chiral azetidine ureas. | ||||
Ref 530389 | Eur J Med Chem. 2009 Dec;44(12):4889-95. Epub 2009 Aug 12.Synthesis and pharmacological evaluation of sulfamide-based analogues of anandamide. | ||||
Ref 530525 | J Med Chem. 2010 Jan 14;53(1):295-315.Indol-3-ylcycloalkyl ketones: effects of N1 substituted indole side chain variations on CB(2) cannabinoid receptor activity. | ||||
Ref 530597 | Bioorg Med Chem Lett. 2010 Feb 1;20(3):1084-9. Epub 2009 Dec 11.Synthesis and SAR of novel imidazoles as potent and selective cannabinoid CB2 receptor antagonists with high binding efficiencies. | ||||
Ref 530617 | Eur J Med Chem. 2010 Mar;45(3):1133-9. Epub 2009 Dec 16.Discovery of benzhydrylpiperazine derivatives as CB1 receptor inverse agonists via privileged structure-based approach. | ||||
Ref 530827 | Bioorg Med Chem Lett. 2010 May 1;20(9):2770-5. Epub 2010 Mar 19.Probing the cannabinoid CB1/CB2 receptor subtype selectivity limits of 1,2-diarylimidazole-4-carboxamides by fine-tuning their 5-substitution pattern. | ||||
Ref 530871 | J Med Chem. 2010 May 27;53(10):4028-37.Discovery of N-[(4R)-6-(4-chlorophenyl)-7-(2,4-dichlorophenyl)-2,2-dimethyl-3,4-dihydro-2H-pyrano[2,3-b]pyridin-4-yl]-5-methyl-1H-pyrazole-3-carboxamide (MK-5596) as a novel cannabinoid-1 receptor (CB1R) inverse agonist for the treatment of obesity. | ||||
Ref 530929 | Bioorg Med Chem Lett. 2010 Jun 15;20(12):3750-4. Epub 2010 Apr 21.Dihydro-pyrano[2,3-b]pyridines and tetrahydro-1,8-naphthyridines as CB1 receptor inverse agonists: synthesis, SAR and biological evaluation. | ||||
Ref 531027 | Bioorg Med Chem. 2010 Aug 1;18(15):5475-82. Epub 2010 Jun 22.Synthesis and pharmacology of 1-methoxy analogs of CP-47,497. | ||||
Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
Ref 531196 | J Med Chem. 2010 Oct 14;53(19):6996-7010.Novel 1',1'-chain substituted hexahydrocannabinols: 9|A-hydroxy-3-(1-hexyl-cyclobut-1-yl)-hexahydrocannabinol (AM2389) a highly potent cannabinoid receptor 1 (CB1) agonist. | ||||
Ref 531214 | Bioorg Med Chem. 2010 Nov 15;18(22):7809-15. Epub 2010 Sep 29.1-Bromo-3-(1',1'-dimethylalkyl)-1-deoxy-|?(8)-tetrahydrocannabinols: New selective ligands for the cannabinoid CB(2) receptor. | ||||
Ref 531715 | Cerebroprotective effects of TAK-937, a cannabinoid receptor agonist, on ischemic brain damage in middle cerebral artery occluded rats and non-human primates. Brain Res. 2012 Jan 9;1430:93-100. | ||||
Ref 531899 | Indole-2-carboxamides as allosteric modulators of the cannabinoid CB??receptor. J Med Chem. 2012 Jun 14;55(11):5627-31. | ||||
Ref 532030 | JD-5006 and JD-5037: peripherally restricted (PR) cannabinoid-1 receptor blockers related to SLV-319 (Ibipinabant) as metabolic disorder therapeutics devoid of CNS liabilities. Bioorg Med Chem Lett. 2012 Oct 1;22(19):6173-80. | ||||
Ref 532853 | Effects of the novel cannabinoid CB1 receptor antagonist PF 514273 on the acquisition and expression of ethanol conditioned place preference. Alcohol. 2014 Aug;48(5):427-31. | ||||
Ref 533285 | A comprehensive patents review on cannabinoid 1 receptor antagonists as antiobesity agents. Expert Opin Ther Pat. 2015 Oct;25(10):1093-116. | ||||
Ref 534130 | Structural features of the central cannabinoid CB1 receptor involved in the binding of the specific CB1 antagonist SR 141716A. J Biol Chem. 1996 Mar 22;271(12):6941-6. | ||||
Ref 534216 | Evaluation of binding in a transfected cell line expressing a peripheral cannabinoid receptor (CB2): identification of cannabinoid receptor subtype selective ligands. J Pharmacol Exp Ther. 1996 Sep;278(3):989-99. | ||||
Ref 534262 | J Med Chem. 1996 Oct 25;39(22):4515-9.Head group analogs of arachidonylethanolamide, the endogenous cannabinoid ligand. | ||||
Ref 534489 | Binding of the non-classical cannabinoid CP 55,940, and the diarylpyrazole AM251 to rodent brain cannabinoid receptors. Life Sci. 1997;61(14):PL 191-7. | ||||
Ref 534535 | Ligand binding and modulation of cyclic AMP levels depend on the chemical nature of residue 192 of the human cannabinoid receptor 1. J Neurochem. 1998 Jan;70(1):366-73. | ||||
Ref 534541 | LY320135, a novel cannabinoid CB1 receptor antagonist, unmasks coupling of the CB1 receptor to stimulation of cAMP accumulation. J Pharmacol Exp Ther. 1998 Jan;284(1):291-7. | ||||
Ref 535198 | Antinociceptive activity of the endogenous fatty acid amide, palmitylethanolamide. Eur J Pharmacol. 2001 May 11;419(2-3):191-8. | ||||
Ref 535887 | Anandamide is able to inhibit trigeminal neurons using an in vivo model of trigeminovascular-mediated nociception. J Pharmacol Exp Ther. 2004 Apr;309(1):56-63. Epub 2004 Jan 12. | ||||
Ref 535946 | The endogenous cannabinoid system protects against colonic inflammation. J Clin Invest. 2004 Apr;113(8):1202-9. | ||||
Ref 536122 | Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60. | ||||
Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
Ref 536549 | Privileged structures: a useful concept for the rational design of new lead drug candidates. Mini Rev Med Chem. 2007 Nov;7(11):1108-19. | ||||
Ref 536731 | Posttraining activation of CB1 cannabinoid receptors in the CA1 region of the dorsal hippocampus impairs object recognition long-term memory. Neurobiol Learn Mem. 2008 Sep;90(2):374-81. Epub 2008 Jun 3. | ||||
Ref 536956 | End of the line for cannabinoid receptor 1 as an anti-obesity target? Nat Rev Drug Discov. 2008 Dec;7(12):961-2. | ||||
Ref 537087 | Emerging strategies for exploiting cannabinoid receptor agonists as medicines. Br J Pharmacol. 2009 Feb;156(3):397-411. | ||||
Ref 537145 | Emerging drugs for the treatment of tobacco dependence. Expert Opin Emerg Drugs. 2009 Mar;14(1):23-32. | ||||
Ref 537149 | Central side-effects of therapies based on CB1 cannabinoid receptor agonists and antagonists: focus on anxiety and depression. Best Pract Res Clin Endocrinol Metab. 2009 Feb;23(1):133-44. | ||||
Ref 537268 | Methanandamide attenuates cocaine-induced hyperthermia in rats by a cannabinoid CB(1)-dopamine D(2) receptor mechanism. Brain Res. 2009 Jan 17. | ||||
Ref 537577 | Opioid receptor and NO/cGMP pathway as a mechanism of peripheral antinociceptive action of the cannabinoid receptor agonist anandamide. Life Sci. 2009 Jul 1. | ||||
Ref 543877 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 56). | ||||
Ref 551296 | Morpholinoalkylindenes as antinociceptive agents: Novel cannabinoid receptor agonists, Bioorg. Med. Chem. Lett. 5(4):381-386 (1995). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.