Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T02551
|
||||
Former ID |
TTDS00013
|
||||
Target Name |
D(3) dopamine receptor
|
||||
Gene Name |
DRD3
|
||||
Synonyms |
Dopamine receptor 3; DRD3
|
||||
Target Type |
Successful
|
||||
Disease | Bipolar disorder [ICD9: 296.0, 296.1, 296.4, 296.5, 296.6, 296.7, 296.8, 300; ICD10: F31, F40-F42] | ||||
Cocaine addiction [ICD9: 304.2; ICD10: F14.2] | |||||
Drug abuse [ICD9: 303-304; ICD10: F10-F19] | |||||
Emesis [ICD9: 787; ICD10: R11] | |||||
Emesis; Gastric motility disorder [ICD9: 294.1, 307.23, 314.00, 314.01, 320-322, 323, 331.0, 332, 333.4, 340, 344.1, 344.81, 348.0, 536.8, 787; ICD10: F02.2, F02.3, F90, F95.2, G00-G37, G83.5, G93.0] | |||||
Female sexual dysfunction [ICD9: 302.7; ICD10: F52] | |||||
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
Male sexual disorders [ICD10: F52] | |||||
Psychotic disorders [ICD9: 290-299; ICD10: F20-F29] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Schizophrenia [ICD9: 295; ICD10: F20] | |||||
Substance dependence [ICD10: F10-F19] | |||||
Unspecified [ICD code not available] | |||||
Function |
Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T02551
|
||||
UniProt ID | |||||
Sequence |
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC |
||||
Drugs and Mode of Action | |||||
Drug(s) | Cariprazine | Drug Info | Approved | Bipolar disorder | [532651], [542650] |
Pramipexole | Drug Info | Approved | Parkinson's disease | [536580], [543322] | |
Ropinirole | Drug Info | Approved | Parkinson's disease | [537532], [542315] | |
CM-2395 | Drug Info | Phase 3 | Schizophrenia | [551513] | |
P2B-001 | Drug Info | Phase 2/3 | Parkinson's disease | [524487] | |
GSK598809 | Drug Info | Phase 2 | Drug abuse | [523147] | |
GSK618334 | Drug Info | Phase 1 | Drug abuse | [522083] | |
Pfizer 10 | Drug Info | Phase 1 | Female sexual dysfunction | [536493] | |
F-15063 | Drug Info | Preclinical | Schizophrenia | [548528] | |
PD-157533 | Drug Info | Preclinical | Schizophrenia | [536463] | |
PD-157695 | Drug Info | Preclinical | Schizophrenia | [536463] | |
PD-158771 | Drug Info | Preclinical | Schizophrenia | [536463] | |
S-33084 | Drug Info | Preclinical | Psychotic disorders | [538794], [547145] | |
S32504 | Drug Info | Preclinical | Parkinson's disease | [526972] | |
U-99194A | Drug Info | Preclinical | Schizophrenia | [536463] | |
Quinelorane | Drug Info | Discontinued in Phase 3 | Male sexual disorders | [543323], [544908] | |
A-437203 | Drug Info | Discontinued in Phase 2 | Psychotic disorders | [547085] | |
BP-897 | Drug Info | Discontinued in Phase 2 | Cocaine addiction | [542612], [547037] | |
MAZAPERTINE | Drug Info | Discontinued in Phase 2 | Discovery agent | [545274] | |
AVE-5997 | Drug Info | Discontinued in Phase 1 | Psychotic disorders | [547685] | |
S-33138 | Drug Info | Discontinued in Phase 1 | Psychotic disorders | [547260] | |
AS-8112 | Drug Info | Terminated | Emesis | [546591] | |
AVE-5997EF | Drug Info | Terminated | Schizophrenia | [536463] | |
BP4.879a | Drug Info | Terminated | Schizophrenia | [536463] | |
BTS-79018 | Drug Info | Terminated | Schizophrenia | [536463] | |
E-2040 | Drug Info | Terminated | Schizophrenia | [546598] | |
GR-218231 | Drug Info | Terminated | Discovery agent | [542030], [546446] | |
PNU-177864 | Drug Info | Terminated | Schizophrenia | [536463] | |
PNU-96391A | Drug Info | Terminated | Substance dependence | [532971] | |
RGH-1756 | Drug Info | Terminated | Schizophrenia | [536463] | |
S32504 | Drug Info | Terminated | Major depressive disorder | [547082] | |
SB-277011 | Drug Info | Terminated | Schizophrenia | [536463], [538907] | |
YM-43611 | Drug Info | Terminated | Psychotic disorders | [546030] | |
Inhibitor | (+)-3-(1-Propyl-piperidin-3-yl)-phenol | Drug Info | [533938] | ||
(+)-BUTACLAMOL | Drug Info | [529789] | |||
(+/-)-7-hydroxy-2-(N,N-di-n-propylamino)tetralin | Drug Info | [529836] | |||
(+/-)-nantenine | Drug Info | [530558] | |||
(-)-3-(1-Propyl-piperidin-3-yl)-benzonitrile | Drug Info | [533938] | |||
(-)-5-hydroxy-2-(dipropylamino)tetralin | Drug Info | [530606] | |||
(2-Benzyl-phenyl)-(2-pyrrolidin-1-yl-ethyl)-amine | Drug Info | [527160] | |||
(4-Dipropylamino-cyclohexylidene)-acetonitrile | Drug Info | [525701] | |||
(4-Ethynyl-cyclohex-3-enyl)-dipropyl-amine | Drug Info | [529734] | |||
(4-Phenylethynyl-cyclohex-3-enyl)-dipropyl-amine | Drug Info | [525701] | |||
(R)-(-)-2-Methyl-apomorphine hydrochloride | Drug Info | [529328] | |||
(R)-(-)-2-Phenyl-apomorphine hydrochloride | Drug Info | [529328] | |||
(R)-2-(Benzylamino-methyl)-chroman-7-ol | Drug Info | [526840] | |||
1-(4-(1H-pyrazol-1-yl)benzyl)-4-phenylpiperazine | Drug Info | [528099] | |||
1-(4-(4-phenyl-1-piperazinyl)butyl)indolin-2-one | Drug Info | [528904] | |||
1-Benzyl-4-(2-ethynyl-pyrrol-1-yl)-piperidine | Drug Info | [525629] | |||
1-Benzyl-4-(2-iodo-pyrrol-1-yl)-piperidine | Drug Info | [525629] | |||
1-Benzyl-4-(2-oxazol-5-yl-pyrrol-1-yl)-piperidine | Drug Info | [525629] | |||
1-Benzyl-4-(3-oxazol-5-yl-pyrrol-1-yl)-piperidine | Drug Info | [525629] | |||
1-Benzyl-4-pyrrol-1-yl-piperidine | Drug Info | [525629] | |||
1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine | Drug Info | [533570] | |||
1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine | Drug Info | [551334] | |||
1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine | Drug Info | [527160] | |||
1-[2-(2-Benzyl-phenoxy)-ethyl]-pyrrolidine | Drug Info | [527160] | |||
1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine | Drug Info | [527160] | |||
2-(4-Dipropylamino-cyclohexylidene)-malononitrile | Drug Info | [525701] | |||
3-(1-Propyl-pyrrolidin-3-yl)-phenol | Drug Info | [551334] | |||
3-(2-Benzylamino-ethoxy)-phenol | Drug Info | [525599] | |||
3-(4-Benzyl-piperazin-1-yl)-phenol | Drug Info | [534802] | |||
3-(4-Methyl-piperidin-1-ylmethyl)-1H-indole | Drug Info | [534131] | |||
3-(4-Phenyl-piperazin-1-ylmethyl)-1H-indole | Drug Info | [534131] | |||
3-(4-Phenyl-piperidin-1-ylmethyl)-1H-indole | Drug Info | [534131] | |||
4-(2-Benzylamino-ethoxy)-1,3-dihydro-indol-2-one | Drug Info | [525599] | |||
4-(4-Benzyl-piperazin-1-yl)-1H-benzoimidazole | Drug Info | [534802] | |||
4-(4-Benzyl-piperazin-1-yl)-1H-indole | Drug Info | [534802] | |||
4-(4-Benzyl-piperazin-1-yl)-5-chloro-1H-indole | Drug Info | [534802] | |||
4-(4-Benzyl-piperazin-1-yl)-7-bromo-1H-indole | Drug Info | [534802] | |||
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
4-Dipropylamino-cyclohex-1-enecarbonitrile | Drug Info | [525701] | |||
A-690344 | Drug Info | [527867] | |||
A-706149 | Drug Info | [527843] | |||
A-987306 | Drug Info | [529789] | |||
Azaperone | Drug Info | [533796] | |||
Benzyl-[2-(1H-indazol-4-yloxy)-ethyl]-amine | Drug Info | [525599] | |||
Benzyl-[2-(1H-indol-4-yloxy)-ethyl]-amine | Drug Info | [525599] | |||
D-189 | Drug Info | [529420] | |||
D-190 | Drug Info | [529420] | |||
D-192 | Drug Info | [529420] | |||
D-193 | Drug Info | [529420] | |||
D-203 | Drug Info | [529420] | |||
D-210 | Drug Info | [529420] | |||
D-218 | Drug Info | [529420] | |||
D-219 | Drug Info | [529420] | |||
D-220 | Drug Info | [529420] | |||
D-237 | Drug Info | [529836] | |||
D-264 | Drug Info | [530117] | |||
D-315 | Drug Info | [531014] | |||
D-366 | Drug Info | [530606] | |||
Etoloxamine | Drug Info | [527160] | |||
FLUMEZAPINE | Drug Info | [533515] | |||
FLUTROLINE | Drug Info | [533512] | |||
GR-218231 | Drug Info | [529862] | |||
ISOCLOZAPINE | Drug Info | [533570] | |||
ISOLOXAPINE | Drug Info | [533577] | |||
L-741626 | Drug Info | [551224] | |||
L-741742 | Drug Info | [534132] | |||
MAZAPERTINE | Drug Info | [533800] | |||
N-(4-Dipropylaminobutyl)-4-biphenylcarboxamide | Drug Info | [529734] | |||
N-(4-Propylaminobutyl)-4-biphenylcarboxamide | Drug Info | [529734] | |||
P2B-001 | Drug Info | [534641] | |||
PG-01037 | Drug Info | [528974] | |||
QUINPIROLE | Drug Info | [530429] | |||
R-226161 | Drug Info | [528772] | |||
SB-271046 | Drug Info | [529191] | |||
SPIPERONE | Drug Info | [527420] | |||
STEPHOLIDINE | Drug Info | [530374] | |||
UH-232 | Drug Info | [551330] | |||
[2-(1H-Benzoimidazol-4-yloxy)-ethyl]-benzyl-amine | Drug Info | [525599] | |||
Antagonist | (+)-AJ76 | Drug Info | [530381] | ||
(+)-S-14297 | Drug Info | [533834] | |||
AS-8112 | Drug Info | [536188] | |||
AS-9705 | Drug Info | [536188] | |||
AVE-5997 | Drug Info | [527957] | |||
AVE-5997EF | Drug Info | [536463] | |||
BP4.879a | Drug Info | [536463] | |||
GSK598809 | Drug Info | [550963] | |||
GSK618334 | Drug Info | [550963] | |||
nafadotride | Drug Info | [534073] | |||
NGB 2904 | Drug Info | [528948] | |||
PD-157533 | Drug Info | [536463] | |||
PD-157695 | Drug Info | [536463] | |||
PD-158771 | Drug Info | [536463] | |||
PNU-177864 | Drug Info | [536463] | |||
RGH-1756 | Drug Info | [536463] | |||
S-33138 | Drug Info | [531061], [551871] | |||
SB-277011 | Drug Info | [536463] | |||
[3H]nemonapride | Drug Info | [526842] | |||
[3H]spiperone | Drug Info | [525818] | |||
Agonist | (-)-N-porphynorapomorphine | Drug Info | [533725] | ||
7-trans-OH-PIPAT | Drug Info | [533838] | |||
CM-2395 | Drug Info | [548980] | |||
PD 128907 | Drug Info | [534074] | |||
PF-592379 | Drug Info | [531866] | |||
Pfizer 10 | Drug Info | [536493] | |||
piribedil | Drug Info | [526443] | |||
[3H]7-OH-DPAT | Drug Info | [533726] | |||
[3H]PD128907 | Drug Info | [533687] | |||
Modulator | 7-OH-DPAT | Drug Info | |||
A-437203 | Drug Info | ||||
BP-897 | Drug Info | ||||
Cariprazine | Drug Info | [532651] | |||
E-2040 | Drug Info | [546599] | |||
F-15063 | Drug Info | ||||
PD-152255 | Drug Info | ||||
PNU-96391A | Drug Info | [532971] | |||
Pramipexole | Drug Info | [556264] | |||
Quinelorane | Drug Info | ||||
Ropinirole | Drug Info | [556264] | |||
S-33084 | Drug Info | [525807] | |||
S32504 | Drug Info | [526972] | |||
YM-43611 | Drug Info | ||||
Binder | BTS-79018 | Drug Info | [536463] | ||
U-99194A | Drug Info | [536463] | |||
Modulator (allosteric modulator) | SB269652 | Drug Info | [533107] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
References | |||||
Ref 522083 | ClinicalTrials.gov (NCT00513279) To Investigate If Single Doses Of GSK618334 Are Safe And To Investigate Blood Levels Of GSK618334. U.S. National Institutes of Health. | ||||
Ref 523147 | ClinicalTrials.gov (NCT01188967) Effectiveness of GSK598809, a Selective D3 Antagonist, Added to Cognitive Behavioral Therapy and Nicotine Replacement Therapy for Smoking Cessation and Prevention of Very Early Relapse to Smoking. U.S. National Institutes of Health. | ||||
Ref 524487 | ClinicalTrials.gov (NCT01968460) Safety, Tolerability and Efficacy of Two Doses of Once Daily P2B001 in Subjects With Early Parkinson's Disease. U.S. National Institutes of Health. | ||||
Ref 526972 | S32504, a novel naphtoxazine agonist at dopamine D3/D2 receptors: II. Actions in rodent, primate, and cellular models of antiparkinsonian activity in comparison to ropinirole. J Pharmacol Exp Ther. 2004 Jun;309(3):921-35. Epub 2004 Feb 20. | ||||
Ref 532971 | The dopamine stabilizer (-)-OSU6162 occupies a subpopulation of striatal dopamine D2/D3 receptors: an [(11)C]raclopride PET study in healthy human subjects. Neuropsychopharmacology. 2015 Jan;40(2):472-9. | ||||
Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
Ref 536493 | Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. Epub 2007 Aug 27. | ||||
Ref 536580 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. Epub 2008 Jan 2. | ||||
Ref 537532 | Update on ropinirole in the treatment of Parkinson's disease. Neuropsychiatr Dis Treat. 2009;5:33-6. Epub 2009 Apr 8. | ||||
Ref 538794 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 129). | ||||
Ref 538907 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 143). | ||||
Ref 542030 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 70). | ||||
Ref 542315 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7295). | ||||
Ref 542612 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7625). | ||||
Ref 542650 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7671). | ||||
Ref 543322 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 953). | ||||
Ref 543323 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 954). | ||||
Ref 544908 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001472) | ||||
Ref 545274 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002662) | ||||
Ref 546030 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005975) | ||||
Ref 546446 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008161) | ||||
Ref 546591 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009088) | ||||
Ref 546598 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126) | ||||
Ref 547037 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012397) | ||||
Ref 547082 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012906) | ||||
Ref 547085 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012940) | ||||
Ref 547145 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013394) | ||||
Ref 547260 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014544) | ||||
Ref 547685 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018413) | ||||
Ref 525599 | Bioorg Med Chem Lett. 1999 Sep 6;9(17):2593-8.New generation dopaminergic agents. 7. Heterocyclic bioisosteres that exploit the 3-OH-phenoxyethylamine D2 template. | ||||
Ref 525629 | Bioorg Med Chem Lett. 1999 Nov 1;9(21):3143-6.Piperidinylpyrroles: design, synthesis and binding properties of novel and selective dopamine D4 receptor ligands. | ||||
Ref 525701 | J Med Chem. 2000 Feb 24;43(4):756-62.Conjugated enynes as nonaromatic catechol bioisosteres: synthesis, binding experiments, and computational studies of novel dopamine receptor agonists recognizing preferentially the D(3) subtype. | ||||
Ref 525807 | S33084, a novel, potent, selective, and competitive antagonist at dopamine D(3)-receptors: II. Functional and behavioral profile compared with GR218,231 and L741,626. J Pharmacol Exp Ther. 2000 Jun;293(3):1063-73. | ||||
Ref 525818 | Regulation of human D(1), d(2(long)), d(2(short)), D(3) and D(4) dopamine receptors by amiloride and amiloride analogues. Br J Pharmacol. 2000 Jul;130(5):1045-59. | ||||
Ref 526443 | Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804. | ||||
Ref 526840 | J Med Chem. 2003 Oct 9;46(21):4377-92.Molecular modeling of the three-dimensional structure of dopamine 3 (D3) subtype receptor: discovery of novel and potent D3 ligands through a hybrid pharmacophore- and structure-based database searching approach. | ||||
Ref 526842 | Potent activation of dopamine D3/D2 heterodimers by the antiparkinsonian agents, S32504, pramipexole and ropinirole. J Neurochem. 2003 Nov;87(3):631-41. | ||||
Ref 526972 | S32504, a novel naphtoxazine agonist at dopamine D3/D2 receptors: II. Actions in rodent, primate, and cellular models of antiparkinsonian activity in comparison to ropinirole. J Pharmacol Exp Ther. 2004 Jun;309(3):921-35. Epub 2004 Feb 20. | ||||
Ref 527160 | J Med Chem. 2004 Aug 12;47(17):4155-8.Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 receptor selectivity. | ||||
Ref 527420 | J Med Chem. 2005 Feb 10;48(3):694-709.Modeling the similarity and divergence of dopamine D2-like receptors and identification of validated ligand-receptor complexes. | ||||
Ref 527843 | Bioorg Med Chem Lett. 2006 Feb;16(3):658-62. Epub 2005 Nov 2.Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: Quinolin(di)one and benzazepin(di)one derivatives. herve.geneste@abbott.com. | ||||
Ref 527867 | Bioorg Med Chem Lett. 2006 Feb;16(3):490-4. Epub 2005 Nov 11.Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: 1H-pyrimidin-2-one derivatives. | ||||
Ref 527957 | Effect of dopamine D3 antagonists on PPI in DBA/2J mice or PPI deficit induced by neonatal ventral hippocampal lesions in rats. Neuropsychopharmacology. 2006 Jul;31(7):1382-92. Epub 2005 Dec 14. | ||||
Ref 528099 | Bioorg Med Chem Lett. 2006 Jun 1;16(11):2955-9. Epub 2006 Mar 24.Synthesis and biological investigations of dopaminergic partial agonists preferentially recognizing the D4 receptor subtype. | ||||
Ref 528772 | Bioorg Med Chem. 2007 Jun 1;15(11):3649-60. Epub 2007 Mar 21.Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-adrenoceptor antagonism. | ||||
Ref 528904 | Bioorg Med Chem. 2007 Sep 1;15(17):5811-8. Epub 2007 Jun 7.Synthesis of novel lactam derivatives and their evaluation as ligands for the dopamine receptors, leading to a D(4)-selective ligand. | ||||
Ref 528948 | Pharmacological actions of NGB 2904, a selective dopamine D3 receptor antagonist, in animal models of drug addiction. CNS Drug Rev. 2007 Summer;13(2):240-59. | ||||
Ref 528974 | J Med Chem. 2007 Aug 23;50(17):4135-46. Epub 2007 Aug 2.Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3 receptor ligands: potential substance abuse therapeutic agents. | ||||
Ref 529191 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. Epub 2007 Nov 17.Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. | ||||
Ref 529328 | Bioorg Med Chem. 2008 Apr 1;16(7):3773-9. Epub 2008 Feb 5.Synthesis and neuropharmacological evaluation of 2-aryl- and alkylapomorphines. | ||||
Ref 529420 | J Med Chem. 2008 May 22;51(10):3005-19. Epub 2008 Apr 12.Bioisosteric heterocyclic versions of 7-{[2-(4-phenyl-piperazin-1-yl)ethyl]propylamino}-5,6,7,8-tetrahydronaphthalen-2-ol: identification of highly potent and selective agonists for dopamine D3 receptor with potent in vivo activity. | ||||
Ref 529734 | J Med Chem. 2008 Nov 13;51(21):6829-38. Epub 2008 Oct 4.Novel D3 selective dopaminergics incorporating enyne units as nonaromatic catechol bioisosteres: synthesis, bioactivity, and mutagenesis studies. | ||||
Ref 529789 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. | ||||
Ref 529836 | J Med Chem. 2008 Dec 25;51(24):7806-19.Structurally constrained hybrid derivatives containing octahydrobenzo[g or f]quinoline moieties for dopamine D2 and D3 receptors: binding characterization at D2/D3 receptors and elucidation of a pharmacophore model. | ||||
Ref 529862 | Bioorg Med Chem. 2009 Jan 15;17(2):758-66. Epub 2008 Nov 24.Design, synthesis, and binding affinities of potential positron emission tomography (PET) ligands with optimal lipophilicity for brain imaging of the dopamine D3 receptor. Part II. | ||||
Ref 530117 | Bioorg Med Chem. 2009 Jun 1;17(11):3923-33. Epub 2009 Apr 19.Investigation of various N-heterocyclic substituted piperazine versions of 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-naphthalen-2-ol: effect on affinity and selectivity for dopamine D3 receptor. | ||||
Ref 530374 | Bioorg Med Chem. 2009 Oct 1;17(19):6898-907. Epub 2009 Aug 20.Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities?. | ||||
Ref 530381 | Molecular cloning and characterization of a novel dopamine receptor (D3) as a target for neuroleptics. Nature. 1990 Sep 13;347(6289):146-51. | ||||
Ref 530429 | J Med Chem. 2009 Nov 12;52(21):6860-70.1,1'-Disubstituted ferrocenes as molecular hinges in mono- and bivalent dopamine receptor ligands. | ||||
Ref 530558 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. Epub 2009 Nov 20.Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. | ||||
Ref 530606 | J Med Chem. 2010 Feb 11;53(3):1023-37.Development of (S)-N6-(2-(4-(isoquinolin-1-yl)piperazin-1-yl)ethyl)-N6-propyl-4,5,6,7-tetrahydrobenzo[d]-thiazole-2,6-diamine and its analogue as a D3 receptor preferring agonist: potent in vivo activity in Parkinson's disease animal models. | ||||
Ref 531014 | Bioorg Med Chem. 2010 Aug 1;18(15):5661-74. Epub 2010 Jun 12.Further delineation of hydrophobic binding sites in dopamine D(2)/D(3) receptors for N-4 substituents on the piperazine ring of the hybrid template 5/7-{[2-(4-aryl-piperazin-1-yl)-ethyl]-propyl-amino}-5,6,7,8-tetrahydro-naphthalen-2-ol. | ||||
Ref 531061 | The dopamine D3 receptor antagonist, S33138, counters cognitive impairment in a range of rodent and primate procedures. Int J Neuropsychopharmacol. 2010 Sep;13(8):1035-51. | ||||
Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
Ref 531866 | Lack of abuse potential in a highly selective dopamine D3 agonist, PF-592,379, in drug self-administration and drug discrimination in rats. Behav Pharmacol. 2012 Jun;23(3):280-91. | ||||
Ref 532971 | The dopamine stabilizer (-)-OSU6162 occupies a subpopulation of striatal dopamine D2/D3 receptors: an [(11)C]raclopride PET study in healthy human subjects. Neuropsychopharmacology. 2015 Jan;40(2):472-9. | ||||
Ref 533107 | Investigation of the binding and functional properties of extended length D3 dopamine receptor-selective antagonists. Eur Neuropsychopharmacol. 2015 Sep;25(9):1448-61. | ||||
Ref 533512 | J Med Chem. 1980 Jun;23(6):635-43.Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. | ||||
Ref 533515 | J Med Chem. 1982 Oct;25(10):1133-40.Effects of conformationally restricted 4-piperazinyl-10H-thienobenzodiazepine neuroleptics on central dopaminergic and cholinergic systems. | ||||
Ref 533570 | J Med Chem. 1982 Jul;25(7):855-8.Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. | ||||
Ref 533577 | J Med Chem. 1981 Sep;24(9):1021-6.Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. | ||||
Ref 533687 | Characterization of binding of [3H]PD 128907, a selective dopamine D3 receptor agonist ligand, to CHO-K1 cells. Life Sci. 1995;57(15):1401-10. | ||||
Ref 533725 | A functional test identifies dopamine agonists selective for D3 versus D2 receptors. Neuroreport. 1995 Jan 26;6(2):329-32. | ||||
Ref 533726 | Radioligand binding characterization of putative dopamine D3 receptor in human peripheral blood lymphocytes with [3H]7-OH-DPAT. J Neuroimmunol. 1995 May;58(2):139-44. | ||||
Ref 533796 | J Med Chem. 1993 Nov 26;36(24):3929-36.Evaluation of the effects of the enantiomers of reduced haloperidol, azaperol, and related 4-amino-1-arylbutanols on dopamine and sigma receptors. | ||||
Ref 533800 | J Med Chem. 1994 Apr 15;37(8):1060-2.A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. | ||||
Ref 533834 | S 14297, a novel selective ligand at cloned human dopamine D3 receptors, blocks 7-OH-DPAT-induced hypothermia in rats. Eur J Pharmacol. 1994 Aug 1;260(2-3):R3-5. | ||||
Ref 533838 | Iodinated 2-aminotetralins and 3-amino-1-benzopyrans: ligands for dopamine D2 and D3 receptors. J Med Chem. 1994 Nov 25;37(24):4245-50. | ||||
Ref 533938 | J Med Chem. 1993 Oct 15;36(21):3188-96.Substituted 3-phenylpiperidines: new centrally acting dopamine autoreceptor antagonists. | ||||
Ref 534073 | Nafadotride, a potent preferential dopamine D3 receptor antagonist, activates locomotion in rodents. J Pharmacol Exp Ther. 1995 Dec;275(3):1239-46. | ||||
Ref 534074 | Neurochemical and functional characterization of the preferentially selective dopamine D3 agonist PD 128907. J Pharmacol Exp Ther. 1995 Dec;275(3):1355-66. | ||||
Ref 534131 | J Med Chem. 1996 May 10;39(10):1941-2.3-((4-(4-Chlorophenyl)piperazin-1-yl)-methyl)-1H-pyrrolo-2,3-b-pyridine: an antagonist with high affinity and selectivity for the human dopamine D4 receptor. | ||||
Ref 534132 | J Med Chem. 1996 May 10;39(10):1943-5.5-(4-Chlorophenyl)-4-methyl-3-(1-(2-phenylethyl)piperidin-4-yl)isoxazole: a potent, selective antagonist at human cloned dopamine D4 receptors. | ||||
Ref 534641 | Pharmacology of pramipexole, a dopamine D3-preferring agonist useful in treating Parkinson's disease. Clin Neuropharmacol. 1998 May-Jun;21(3):141-51. | ||||
Ref 534802 | Bioorg Med Chem Lett. 1998 Oct 6;8(19):2675-80.New generation dopaminergic agents. 5. Heterocyclic bioisosteres that exploit the 3-OH-N1-phenylpiperazine dopaminergic template. | ||||
Ref 536188 | Emerging drugs for chemotherapy-induced emesis. Expert Opin Emerg Drugs. 2006 Mar;11(1):137-51. | ||||
Ref 536463 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. Epub 2007 Jul 31. | ||||
Ref 536493 | Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. Epub 2007 Aug 27. | ||||
Ref 546599 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009126) | ||||
Ref 548980 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031127) | ||||
Ref 551224 | Synthesis and characterization of selective dopamine D2 receptor antagonists. 2. Azaindole, benzofuran, and benzothiophene analogs of L-741,626. Bioorg Med Chem. 2010 Jul 15;18(14):5291-300. doi: 10.1016/j.bmc.2010.05.052. Epub 2010 May 24. | ||||
Ref 551330 | (Dipropylamino)-tetrahydronaphthofurans: centrally acting serotonin agonists and dopamine agonists-antagonists, Bioorg. Med. Chem. Lett. 7(21):2759-2764 (1997). | ||||
Ref 551334 | Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.