Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T60529
|
||||
Former ID |
TTDS00040
|
||||
Target Name |
Prostaglandin G/H synthase 1
|
||||
Gene Name |
PTGS1
|
||||
Synonyms |
COX-1; Cyclooxygenase -1; Cyclooxygenase-1; PGH synthase 1; PGHS-1; PHS 1; Prostaglandin H2 synthase 1; Prostaglandin-endoperoxide synthase 1; PTGS1
|
||||
Target Type |
Successful
|
||||
Disease | Acne vulgaris; Dermatitis [ICD9:706.1, 692.9; ICD10: L70.0, L20-L30] | ||||
Alzheimer disease [ICD9: 331; ICD10: G30] | |||||
Arthritis [ICD9: 710-719; ICD10: M00-M25] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Colorectal cancer [ICD9: 153, 154; ICD10: C18-C21] | |||||
Dietary shortage [ICD9: 260-269; ICD10: E40-E46] | |||||
Diabetic neuropathy [ICD9: 250, 250.6, 356.0, 356.8; ICD10: E11.40] | |||||
Dysmenorrhea [ICD9: 625.3; ICD10: N94.4-N94.6] | |||||
Gout [ICD9: 274.00274.1274.8274.9; ICD10: M10] | |||||
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51] | |||||
Inflammation [ICD10: E08-E13, E10.2, E11, E11.2, E13.2, I73.9, I80-I82, N00-N29, G89] | |||||
Joint and muscular pain; Arthritis; Dysmenorrhea [ICD10: M00-M25, N94] | |||||
Miosis during ocular surgery; Dysmenorrhea [ICD9:379.42, 625.3; ICD10: H57.03, N94.4-N94.6] | |||||
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
Osteoarthritis; Rheumatoid arthritis [ICD9: 714, 715; ICD10: M05-M06, M15-M19, M47] | |||||
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
Postoperative inflammation [ICD9: 998; ICD10: T81] | |||||
Rheumatold arthritis; Osteoarthritis [ICD9: 714, 715; ICD10: M05-M06, M15-M19, M47] | |||||
Type 2 diabetes [ICD9: 250; ICD10: E11] | |||||
Ulcerative colitis [ICD9: 556; ICD10: K51] | |||||
Unspecified [ICD code not available] | |||||
Function |
May play an important role in regulating or promoting cell proliferation in some normal and neoplastically transformed cells.
|
||||
BioChemical Class |
Oxidoreductases acting on paired donors
|
||||
Target Validation |
T60529
|
||||
UniProt ID | |||||
EC Number |
EC 1.14.99.1
|
||||
Sequence |
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL |
||||
Drugs and Mode of Action | |||||
Drug(s) | Aminosalicylic Acid | Drug Info | Approved | Inflammatory bowel disease | [1] |
Balsalazide | Drug Info | Approved | Inflammatory bowel disease | [2] | |
Bromfenac | Drug Info | Approved | Postoperative inflammation | [3], [4] | |
FENBUFEN | Drug Info | Approved | Arthritis | [1] | |
Flufenamic Acid | Drug Info | Approved | Dysmenorrhea | [5], [1] | |
Gamma-Homolinolenic acid | Drug Info | Approved | Dietary shortage | [6] | |
Meclofenamate Sodium | Drug Info | Approved | Joint and muscular pain; Arthritis; Dysmenorrhea | [1] | |
Mesalazine | Drug Info | Approved | Ulcerative colitis | [7], [8] | |
Naproxen | Drug Info | Approved | Osteoarthritis; Rheumatoid arthritis | [1] | |
Piroxicam | Drug Info | Approved | Pain | [9], [10] | |
Salicyclic acid | Drug Info | Approved | Acne vulgaris; Dermatitis | [11], [12], [1] | |
Salsalate | Drug Info | Approved | Rheumatold arthritis; Osteoarthritis | [13], [1] | |
Suprofen | Drug Info | Approved | Miosis during ocular surgery; Dysmenorrhea | [14], [15], [1] | |
IMRECOXIB | Drug Info | Phase 4 | Discovery agent | [16] | |
Curcumin | Drug Info | Phase 3 | Cancer | [17], [18] | |
diclofenac sodium patch | Drug Info | Phase 3 | Unspecified | [19] | |
DOCOSAHEXAENOIC ACID | Drug Info | Phase 3 | Alzheimer disease | [20] | |
ThermoProfen | Drug Info | Phase 3 | Pain | [21] | |
EPICATECHIN | Drug Info | Phase 2 | Discovery agent | [22] | |
Naproxen | Drug Info | Phase 2 | Pain | [23], [24] | |
EXO-230 | Drug Info | Phase 1/2 | Diabetic neuropathy | [25] | |
Bromfenac | Drug Info | Withdrawn from market | Inflammatory disease | [4], [1] | |
INDOPROFEN | Drug Info | Withdrawn from market | Gout | [1] | |
CRx-401 | Drug Info | Discontinued in Phase 2 | Type 2 diabetes | [26] | |
R-KETOPROFEN | Drug Info | Discontinued in Phase 2 | Discovery agent | [27] | |
SRT501 | Drug Info | Discontinued in Phase 2 | Colorectal cancer | [28] | |
TEBUFELONE | Drug Info | Discontinued in Phase 2 | Pain | [29] | |
ATLIPROFEN METHYL ESTER | Drug Info | Terminated | Inflammation | [30] | |
SC-58451 | Drug Info | Terminated | Discovery agent | [31] | |
Inhibitor | (-)-3-O-acetylspectaline | Drug Info | [32] | ||
(11H-Dibenzo[b,e][1,4]dioxepin-2-yl)-acetic acid | Drug Info | [33] | |||
(11H-Dibenzo[b,e][1,4]dioxepin-7-yl)-acetic acid | Drug Info | [33] | |||
(11H-Dibenzo[b,e][1,4]dioxepin-8-yl)-acetic acid | Drug Info | [33] | |||
(3-Chloro-4-Propoxy-Phenyl)-Acetic Acid | Drug Info | [34] | |||
(R)-2-(4-Isobutyl-phenyl)-N-phenyl-propionamide | Drug Info | [35] | |||
(S)-FLURBIPROFEN | Drug Info | [35] | |||
(Z)-2'-des-methyl sulindac sulfide | Drug Info | [36] | |||
1,2-dihydro-3-(2,3,4-trimethoxyphenyl)naphthalene | Drug Info | [37] | |||
1-(4-(methylsulfonyl)phenyl)-3-p-tolylurea | Drug Info | [38] | |||
1-(4-(methylsulfonyl)phenyl)-3-phenylurea | Drug Info | [38] | |||
1-(4-aminosulfonylphenyl)-2-(2-pyridyl)acetylene | Drug Info | [39] | |||
1-(4-aminosulfonylphenyl)-2-(4-pyridyl)acetylene | Drug Info | [39] | |||
2'-epi-guianin | Drug Info | [40] | |||
2,4'-Dimethoxy-5,3'-di-(2-propenyl)-biphenyl | Drug Info | [41] | |||
2-(1,1'-Biphenyl-4-Yl)Propanoic Acid | Drug Info | [34] | |||
2-(2,3,4-trimethoxyphenyl)-1H-indene | Drug Info | [37] | |||
2-(2-(2,6-dimethylphenylamino)phenyl)acetic acid | Drug Info | [42] | |||
2-(2-methoxyphenyl)-1H-indene | Drug Info | [37] | |||
2-(2-Methylpropanoyl)-1,3,5-benzenetriol | Drug Info | [43] | |||
2-(3'-Allyl-biphenyl-4-yl)-propionic acid | Drug Info | [44] | |||
2-(3'-Ethyl-biphenyl-4-yl)-propionic acid | Drug Info | [44] | |||
2-(3'-Ethylsulfanyl-biphenyl-4-yl)-propionic acid | Drug Info | [44] | |||
2-(3'-Vinyl-biphenyl-4-yl)-propionic acid | Drug Info | [44] | |||
2-(3-Phenyl-propyl)-1,2-dihydro-indazol-3-one | Drug Info | [45] | |||
2-(N-(2-Ffuorophenyl)pyrrol-3-yl) acetic acid | Drug Info | [46] | |||
2-(N-(2-fluorophenyl)pyrrol-2-yl) acetic acid | Drug Info | [46] | |||
2-(p-Methylsulfonylbenzoyl)furan | Drug Info | [47] | |||
2-Benzyl-1,2-dihydro-indazol-3-one | Drug Info | [45] | |||
2-Bromoacetyl Group | Drug Info | [48] | |||
2-Furan-2-ylmethyl-1,2-dihydro-indazol-3-one | Drug Info | [45] | |||
2-Methyl-1,2-dihydro-indazol-3-one | Drug Info | [45] | |||
2-Naphthalen-2-ylmethyl-1,2-dihydro-indazol-3-one | Drug Info | [45] | |||
2-Phenethyl-1,2-dihydro-indazol-3-one | Drug Info | [45] | |||
2-Phenyl-1,2-dihydro-indazol-3-one | Drug Info | [45] | |||
2-[4-(1H-Indol-5-yl)-phenyl]-propionic acid | Drug Info | [44] | |||
3 beta-O-acetyloleanolic acid | Drug Info | [49] | |||
3-(4-Methanesulfonyl-phenyl)-1-phenyl-propynone | Drug Info | [50] | |||
4'-Methoxy-5,3'-dipropyl-biphenyl-2ol | Drug Info | [41] | |||
4,5-Bis(4-chlorophenyl)-1,2-selenazole | Drug Info | [51] | |||
4,5-Bis(4-chlorophenyl)isothiazole | Drug Info | [52] | |||
4,5-Bis(4-methoxyphenyl)-1,2-selenazole | Drug Info | [51] | |||
4,5-Bis(4-methoxyphenyl)-3H-1,2-dithiol-3-one | Drug Info | [52] | |||
4,5-Bis(4-methoxyphenyl)-3H-1,2-dithiole-3-thione | Drug Info | [52] | |||
4,5-Bis(4-methoxyphenyl)isothiazole | Drug Info | [52] | |||
4-(4-Chlorophenyl)-5-(4-methoxyphenyl)isothiazole | Drug Info | [52] | |||
4-(4-Chlorophenyl)-5-p-tolyl-1,2-selenazole | Drug Info | [51] | |||
4-(4-Chlorophenyl)-5-p-tolyl-3H-1,2-dithiol-3-one | Drug Info | [52] | |||
4-(4-Chlorophenyl)-5-p-tolylisothiazole | Drug Info | [52] | |||
4-(5-(4-Hydroxyphenyl)isothiazol-4-yl)phenol | Drug Info | [52] | |||
4-amino-N-(2-chlorophenyl)benzenesulfonamide | Drug Info | [53] | |||
4-amino-N-(4-chlorophenyl)benzenesulfonamide | Drug Info | [53] | |||
4-amino-N-p-tolylbenzenesulfonamide | Drug Info | [53] | |||
5,3'-Dipropyl-biphenyl-2,4'-diol | Drug Info | [41] | |||
5-(2-1H-indenyl)-1,3-benzodioxole | Drug Info | [37] | |||
5-(2-Imidazol-1-yl-ethyl)-7,8-dihydro-quinoline | Drug Info | [54] | |||
5-(4-Chlorophenyl)-4-(4-methoxyphenyl)isothiazole | Drug Info | [52] | |||
5-(4-Chlorophenyl)-4-p-tolyl-1,2-selenazole | Drug Info | [51] | |||
5-(4-Chlorophenyl)-4-p-tolyl-3H-1,2-dithiol-3-one | Drug Info | [52] | |||
5-(4-Chlorophenyl)-4-p-tolylisothiazole | Drug Info | [52] | |||
5-(4-Methoxyphenyl)-4-p-tolyl-1,2-selenazole | Drug Info | [51] | |||
5-(4-Methoxyphenyl)-4-p-tolylisothiazole | Drug Info | [52] | |||
5-Ethyl-3,4-diphenyl-isoxazole | Drug Info | [55] | |||
5-Methyl-3,4-diphenyl-isoxazole | Drug Info | [55] | |||
5-Phenyl-pentanoic acid benzyl-hydroxy-amide | Drug Info | [56] | |||
Acetic acid 2-hept-2-ynylsulfanyl-phenyl ester | Drug Info | [57] | |||
Acetic acid 2-hept-3-ynylsulfanyl-phenyl ester | Drug Info | [57] | |||
Acetic acid 2-heptylselanyl-phenyl ester | Drug Info | [57] | |||
Acetic acid 2-heptylsulfanyl-phenyl ester | Drug Info | [57] | |||
Acetic acid 2-hex-2-ynylsulfanyl-phenyl ester | Drug Info | [57] | |||
Acetic acid 2-hexylsulfanyl-phenyl ester | Drug Info | [57] | |||
Acetic acid 2-pentylsulfanyl-phenyl ester | Drug Info | [57] | |||
Acetic Acid Salicyloyl-Amino-Ester | Drug Info | [34] | |||
Alpha-D-Mannose | Drug Info | [48] | |||
Alpha-Methyl-4-biphenyl-acetic acid | Drug Info | [58] | |||
Arachidonic Acid | Drug Info | [48] | |||
B-Octylglucoside | Drug Info | [48] | |||
Balsalazide | Drug Info | [59] | |||
Beta-D-Glucose | Drug Info | [48] | |||
Beta-D-Mannose | Drug Info | [48] | |||
Bromfenac | Drug Info | [60] | |||
CATECHIN | Drug Info | [61] | |||
CRx-401 | Drug Info | [62] | |||
Curcumin | Drug Info | [63] | |||
DEMETHOXYCURCUMIN | Drug Info | [63] | |||
DOCOSAHEXAENOIC ACID | Drug Info | [64] | |||
EPICATECHIN | Drug Info | [61] | |||
FENBUFEN | Drug Info | [65] | |||
Flufenamic Acid | Drug Info | [66] | |||
FR122047 | Drug Info | [67] | |||
Gamma-Homolinolenic acid | Drug Info | [68], [69], [70] | |||
Heme | Drug Info | [34] | |||
HONOKIOL | Drug Info | [41] | |||
Hyperforin | Drug Info | [71] | |||
IMRECOXIB | Drug Info | [72] | |||
INDOPROFEN | Drug Info | [35] | |||
IODOINDOMETHACIN | Drug Info | [58] | |||
IODOSUPROFEN | Drug Info | [58] | |||
Mesalazine | Drug Info | [73] | |||
METHYLHONOKIOL | Drug Info | [41] | |||
N-(1H-indazol-5-yl)acetamide | Drug Info | [74] | |||
N-(3-(phenylthio)pyridin-4-yl)methanesulfonamide | Drug Info | [75] | |||
N-(3-phenoxy-4-pyridinyl)ethanesulfonamide | Drug Info | [76] | |||
N-(3-phenoxy-4-pyridinyl)propanesulfonamide | Drug Info | [76] | |||
N-(3-phenoxypyridin-4-yl)methanesulfonamide | Drug Info | [75] | |||
N-(3-phenylamino-4-pyridinyl)methanesulfonamide | Drug Info | [75] | |||
Naproxen | Drug Info | [77] | |||
O-Acetylserine | Drug Info | [48] | |||
Oxametacin | Drug Info | [78] | |||
P-(2'-Iodo-5'-Thenoyl)Hydrotropic Acid | Drug Info | [34] | |||
PHENIDONE | Drug Info | [45] | |||
Prifelone | Drug Info | [79] | |||
Primary alcohol metabolite of celecoxib | Drug Info | [80] | |||
Protoporphyrin Ix Containing Co | Drug Info | [48] | |||
R-KETOPROFEN | Drug Info | [35] | |||
RESORCINOL | Drug Info | [61] | |||
Resveratrol Potassium3-Sulfate | Drug Info | [81] | |||
Resveratrol Potassium4,-Sulfate | Drug Info | [81] | |||
Salicyclic acid | Drug Info | [82] | |||
Salsalate | Drug Info | [83], [84] | |||
SC-560 | Drug Info | [85] | |||
SC-58451 | Drug Info | [86] | |||
Suprofen | Drug Info | [87] | |||
TEBUFELONE | Drug Info | [88] | |||
ThermoProfen | Drug Info | [89] | |||
TRL-382 | Drug Info | [90] | |||
Modulator | Aminosalicylic Acid | Drug Info | [91] | ||
ATLIPROFEN METHYL ESTER | Drug Info | [91] | |||
diclofenac sodium patch | Drug Info | ||||
Meclofenamate Sodium | Drug Info | ||||
Nitroflurbiprofen | Drug Info | ||||
Piroxicam | Drug Info | [91] | |||
SRT501 | Drug Info | [92] | |||
Agonist | EXO-230 | Drug Info | [93] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | C20 prostanoid biosynthesis | ||||
KEGG Pathway | Arachidonic acid metabolism | ||||
Metabolic pathways | |||||
Platelet activation | |||||
Serotonergic synapse | |||||
NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
PathWhiz Pathway | Arachidonic Acid Metabolism | ||||
WikiPathways | Prostaglandin Synthesis and Regulation | ||||
Arachidonic acid metabolism | |||||
Phase 1 - Functionalization of compounds | |||||
Eicosanoid Synthesis | |||||
Selenium Micronutrient Network | |||||
References | |||||
REF 1 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 2 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 077806. | ||||
REF 3 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 021664. | ||||
REF 4 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7131). | ||||
REF 5 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2447). | ||||
REF 6 | Treatment of rheumatoid arthritis with gammalinolenic acid. Ann Intern Med. 1993 Nov 1;119(9):867-73. | ||||
REF 7 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4655). | ||||
REF 8 | BiDil: assessing a race-based pharmaceutical. Ann Fam Med. 2006 Nov-Dec;4(6):556-60. | ||||
REF 9 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 073535. | ||||
REF 10 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7273). | ||||
REF 11 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4306). | ||||
REF 12 | Drug information of Salicyclic acid, 2008. eduDrugs. | ||||
REF 13 | Drug information of Salsalate, 2008. eduDrugs. | ||||
REF 14 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7298). | ||||
REF 15 | Drug information of Suprofen, 2008. eduDrugs. | ||||
REF 16 | ClinicalTrials.gov (NCT01985165) A Phase 4 Study of Imrecoxib in Treatment of Knee Osteoarthritis. U.S. National Institutes of Health. | ||||
REF 17 | Nanocurcumin: a promising therapeutic advancement over native curcumin. Crit Rev Ther Drug Carrier Syst. 2013;30(4):331-68. | ||||
REF 18 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7000). | ||||
REF 19 | Diclofenac: an update on its mechanism of action and safety profile.Curr Med Res Opin.2010 Jul;26(7):1715-31. | ||||
REF 20 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1051). | ||||
REF 21 | ClinicalTrials.gov (NCT00488267) Efficacy of ThermoProfen in Patients With Mild to Moderate Pain Associated With Osteoarthritis of the Knee. U.S. National Institutes of Health. | ||||
REF 22 | ClinicalTrials.gov (NCT01690676) Effect of an Apple Polyphenol Extract on Brachial Artery Flow-mediated Vasodilatory Function. U.S. National Institutes of Health. | ||||
REF 23 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5230). | ||||
REF 24 | ClinicalTrials.gov (NCT01139190) Clinical Trial Evaluating Gastrointestinal Damage Following Administration PL3100 or Naproxen in At-Risk Adults. U.S. National Institutes of Health. | ||||
REF 25 | ClinicalTrials.gov (NCT00544934) Multiple Dose Trial of Anti-glycation Agent GLY-230 in Healthy and Diabetic Subjects. U.S. National Institutes of Health. | ||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018957) | ||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007136) | ||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018787) | ||||
REF 29 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002346) | ||||
REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000964) | ||||
REF 31 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006812) | ||||
REF 32 | J Nat Prod. 2007 Dec;70(12):2026-8. Epub 2007 Nov 30.Lipoperoxidation and cyclooxygenase enzyme inhibitory piperidine alkaloids from Cassia spectabilis green fruits. | ||||
REF 33 | J Med Chem. 1986 Aug;29(8):1436-41.Synthesis and antiinflammatory/analgesic activities of 11H-dibenzo[b, e,][1,4]dioxepinacetic acids. | ||||
REF 34 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
REF 35 | J Med Chem. 2005 Jun 30;48(13):4312-31.2-Arylpropionic CXC chemokine receptor 1 (CXCR1) ligands as novel noncompetitive CXCL8 inhibitors. | ||||
REF 36 | Bioorg Med Chem Lett. 2009 Jun 15;19(12):3271-4. Epub 2009 Apr 23.The influence of double bond geometry in the inhibition of cyclooxygenases by sulindac derivatives. | ||||
REF 37 | Bioorg Med Chem. 2007 Sep 15;15(18):6109-18. Epub 2007 Jun 20.'Bridged' stilbene derivatives as selective cyclooxygenase-1 inhibitors. | ||||
REF 38 | Bioorg Med Chem Lett. 2008 Feb 15;18(4):1336-9. Epub 2008 Jan 11.Design and synthesis of 1,3-diarylurea derivatives as selective cyclooxygenase (COX-2) inhibitors. | ||||
REF 39 | Bioorg Med Chem. 2008 Feb 15;16(4):1948-56. Epub 2007 Nov 5.Synthesis and cyclooxygenase inhibitory activities of linear 1-(methanesulfonylphenyl or benzenesulfonamido)-2-(pyridyl)acetylene regioisomers. | ||||
REF 40 | Bioorg Med Chem Lett. 2009 Dec 15;19(24):6922-5. Epub 2009 Oct 20.COX, LOX and platelet aggregation inhibitory properties of Lauraceae neolignans. | ||||
REF 41 | Bioorg Med Chem. 2009 Jul 1;17(13):4459-65. Epub 2009 May 18.Design and synthesis of ten biphenyl-neolignan derivatives and their in vitro inhibitory potency against cyclooxygenase-1/2 activity and 5-lipoxygenase-mediated LTB4-formation. | ||||
REF 42 | J Biol Chem. 2007 Jun 1;282(22):16379-90. Epub 2007 Apr 12.Molecular determinants for the selective inhibition of cyclooxygenase-2 by lumiracoxib. | ||||
REF 43 | J Nat Prod. 2005 Oct;68(10):1545-8.Anti-inflammatory acylphloroglucinol derivatives from Hops (Humulus lupulus). | ||||
REF 44 | Bioorg Med Chem Lett. 1999 Feb 8;9(3):307-12.Structure-based design of COX-2 selectivity into flurbiprofen. | ||||
REF 45 | J Med Chem. 1991 Mar;34(3):1028-36.Indazolinones, a new series of redox-active 5-lipoxygenase inhibitors with built-in selectivity and oral activity. | ||||
REF 46 | Bioorg Med Chem. 2007 Jul 15;15(14):4876-90. Epub 2007 May 3.Synthesis and biological activity of new anti-inflammatory compounds containing the 1,4-benzodioxine and/or pyrrole system. | ||||
REF 47 | J Med Chem. 2010 Sep 23;53(18):6560-71.Synthesis, anti-inflammatory activity, and in vitro antitumor effect of a novel class of cyclooxygenase inhibitors: 4-(aryloyl)phenyl methyl sulfones. | ||||
REF 48 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 49 | J Nat Prod. 2006 Jun;69(6):887-90.Nitrogen-containing phorbol esters from Croton ciliatoglandulifer and their effects on cyclooxygenases-1 and -2. | ||||
REF 50 | Bioorg Med Chem Lett. 2005 Nov 1;15(21):4842-5.Synthesis and biological evaluation of 1,3-diphenylprop-2-yn-1-ones as dual inhibitors of cyclooxygenases and lipoxygenases. | ||||
REF 51 | Eur J Med Chem. 2008 Jun;43(6):1152-9. Epub 2007 Sep 22.Investigations concerning the COX/5-LOX inhibiting and hydroxyl radical scavenging potencies of novel 4,5-diaryl isoselenazoles. | ||||
REF 52 | Bioorg Med Chem. 2009 Jan 15;17(2):558-68. Epub 2008 Dec 6.Diaryl-dithiolanes and -isothiazoles: COX-1/COX-2 and 5-LOX-inhibitory, *OH scavenging and anti-adhesive activities. | ||||
REF 53 | Bioorg Med Chem. 2007 Jan 15;15(2):1014-21. Epub 2006 Oct 18.Analgesic agents without gastric damage: design and synthesis of structurally simple benzenesulfonanilide-type cyclooxygenase-1-selectiveinhibitors. | ||||
REF 54 | J Med Chem. 2000 May 4;43(9):1841-51.1-imidazolyl(alkyl)-substituted di- and tetrahydroquinolines and analogues: syntheses and evaluation of dual inhibitors of thromboxane A(2) synthase and aromatase. | ||||
REF 55 | J Med Chem. 2004 Sep 23;47(20):4881-90.Novel synthesis of 3,4-diarylisoxazole analogues of valdecoxib: reversal cyclooxygenase-2 selectivity by sulfonamide group removal. | ||||
REF 56 | J Med Chem. 1989 Aug;32(8):1836-42.Differential effects of a series of hydroxamic acid derivatives on 5-lipoxygenase and cyclooxygenase from neutrophils and 12-lipoxygenase from platelets and their in vivo effects on inflammation and anaphylaxis. | ||||
REF 57 | J Med Chem. 1998 Nov 19;41(24):4800-18.Covalent modification of cyclooxygenase-2 (COX-2) by 2-acetoxyphenyl alkyl sulfides, a new class of selective COX-2 inactivators. | ||||
REF 58 | Bioorg Med Chem. 2010 Mar 15;18(6):2204-18. Epub 2010 Feb 8.In silico search for multi-target anti-inflammatories in Chinese herbs and formulas. | ||||
REF 59 | Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. | ||||
REF 60 | Comparison of cyclooxygenase inhibitory activity and ocular anti-inflammatory effects of ketorolac tromethamine and bromfenac sodium. Curr Med Res Opin. 2006 Jun;22(6):1133-40. | ||||
REF 61 | J Nat Prod. 2004 Nov;67(11):1777-82.Mechanism-based inactivation of COX-1 by red wine m-hydroquinones: a structure-activity relationship study. | ||||
REF 62 | ClinicalTrials.gov (NCT00506298) Study of CRx-401 on Glucose Levels in Subjects With Type II Diabetes. U.S. National Institutes of Health. | ||||
REF 63 | Bioorg Med Chem Lett. 2005 Apr 1;15(7):1793-7.Design, synthesis, biological evaluation and molecular docking of curcumin analogues as antioxidant, cyclooxygenase inhibitory and anti-inflammatory agents. | ||||
REF 64 | J Nat Prod. 2001 Jun;64(6):745-9.Cox-2 inhibitory effects of naturally occurring and modified fatty acids. | ||||
REF 65 | Eur J Med Chem. 2009 Sep;44(9):3798-804. Epub 2009 Apr 14.Fenbufen based 3-[5-(substituted aryl)-1,3,4-oxadiazol-2-yl]-1-(biphenyl-4-yl)propan-1-ones as safer antiinflammatory and analgesic agents. | ||||
REF 66 | Ouellet M, Percival MD: Effect of inhibitor time-dependency on selectivity towards cyclooxygenase isoforms. Biochem J. 1995 Feb 15;306 ( Pt 1):247-51. | ||||
REF 67 | The analgesic effect profile of FR122047, a selective cyclooxygenase-1 inhibitor, in chemical nociceptive models. Eur J Pharmacol. 2000 Mar 10;391(1-2):49-54. | ||||
REF 68 | Mutational and X-ray crystallographic analysis of the interaction of dihomo-gamma -linolenic acid with prostaglandin endoperoxide H synthases. J Biol Chem. 2001 Mar 30;276(13):10358-65. Epub 2000 Dec 19. | ||||
REF 69 | Structure of eicosapentaenoic and linoleic acids in the cyclooxygenase site of prostaglandin endoperoxide H synthase-1. J Biol Chem. 2001 Oct 5;276(40):37547-55. Epub 2001 Jul 27. | ||||
REF 70 | Differential metabolism of dihomo-gamma-linolenic acid and arachidonic acid by cyclo-oxygenase-1 and cyclo-oxygenase-2: implications for cellular synthesis of prostaglandin E1 and prostaglandin E2. Biochem J. 2002 Jul 15;365(Pt 2):489-96. | ||||
REF 71 | Hyperforin is a dual inhibitor of cyclooxygenase-1 and 5-lipoxygenase. Biochem Pharmacol. 2002 Dec 15;64(12):1767-75. | ||||
REF 72 | Bioorg Med Chem Lett. 2009 Apr 15;19(8):2270-2. Epub 2009 Feb 27.Synthesis and anti-inflammatory activity of the major metabolites of imrecoxib. | ||||
REF 73 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 74 | J Med Chem. 2008 Dec 25;51(24):7800-5.New analgesics synthetically derived from the paracetamol metabolite N-(4-hydroxyphenyl)-(5Z,8Z,11Z,14Z)-icosatetra-5,8,11,14-enamide. | ||||
REF 75 | J Med Chem. 2009 Oct 8;52(19):5864-71.Pyridine analogues of nimesulide: design, synthesis, and in vitro and in vivo pharmacological evaluation as promising cyclooxygenase 1 and 2 inhibitors. | ||||
REF 76 | J Med Chem. 2004 Dec 30;47(27):6749-59.Design, synthesis, and pharmacological evaluation of pyridinic analogues of nimesulide as cyclooxygenase-2 selective inhibitors. | ||||
REF 77 | Comparative inhibitory activity of rofecoxib, meloxicam, diclofenac, ibuprofen, and naproxen on COX-2 versus COX-1 in healthy volunteers. J Clin Pharmacol. 2000 Oct;40(10):1109-20. | ||||
REF 78 | J Med Chem. 2007 Dec 13;50(25):6367-82. Epub 2007 Nov 10.Structure-based design, synthesis, and biological evaluation of indomethacin derivatives as cyclooxygenase-2 inhibiting nitric oxide donors. | ||||
REF 79 | J Med Chem. 2005 Oct 20;48(21):6523-43.Designed multiple ligands. An emerging drug discovery paradigm. | ||||
REF 80 | Bioorg Med Chem. 2008 Nov 15;16(22):9694-8. Epub 2008 Oct 5.Diazen-1-ium-1,2-diolated nitric oxide donor ester prodrugs of 5-(4-hydroxymethylphenyl)-1-(4-aminosulfonylphenyl)-3-trifluoromethyl-1H-pyrazole and its methanesulfonyl analog: synthesis, biological evaluation and nitric oxide release studies. | ||||
REF 81 | J Med Chem. 2010 Jul 8;53(13):5033-43.Selective synthesis and biological evaluation of sulfate-conjugated resveratrol metabolites. | ||||
REF 82 | The C50T polymorphism of the cyclooxygenase-1 gene and the risk of thrombotic events during low-dose therapy with acetyl salicylic acid. Thromb Haemost. 2008 Jul;100(1):70-5. | ||||
REF 83 | Aspirin and NSAID sensitivity. Immunol Allergy Clin North Am. 2004 Aug;24(3):491-505, vii. | ||||
REF 84 | New non-steroidal anti-rheumatic drugs: selective inhibitors of inducible cyclooxygenase. Med Klin (Munich). 1998 Jul 15;93(7):407-15. | ||||
REF 85 | J Med Chem. 2005 Oct 6;48(20):6400-8.Synthesis and antiinflammatory activity of coumarin derivatives. | ||||
REF 86 | Novel 1,2-diarylcyclobutenes: Selective and orally active cox-2 inhibitors, Bioorg. Med. Chem. Lett. 6(22):2677-2682 (1996). | ||||
REF 87 | Differential binding mode of diverse cyclooxygenase inhibitors. J Mol Graph Model. 2002 Mar;20(5):359-71. | ||||
REF 88 | J Med Chem. 1998 Mar 26;41(7):1124-37.New cyclooxygenase-2/5-lipoxygenase inhibitors. 2. 7-tert-butyl-2,3-dihydro-3,3-dimethylbenzofuran derivatives as gastrointestinal safe antiinflammatory and analgesic agents: variations of the dihydrobenzofuran ring. | ||||
REF 89 | Topical NSAID therapy for musculoskeletal pain. Pain Med. 2010 Apr;11(4):535-49. | ||||
REF 90 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1375). | ||||
REF 91 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | ||||
REF 92 | Resveratrol is a peroxidase-mediated inactivator of COX-1 but not COX-2: a mechanistic approach to the design of COX-1 selective agents. J Biol Chem. 2004 May 21;279(21):22727-37. Epub 2004 Mar 12. | ||||
REF 93 | Inhibiting Amadori-modified albumin formation improves biomarkers of podocyte damage in diabetic rats. Physiol Rep. 2013 September; 1(4): e00083. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.