Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T83011
|
||||
Former ID |
TTDS00341
|
||||
Target Name |
Amine oxidase [flavin-containing] B
|
||||
Gene Name |
MAOB
|
||||
Synonyms |
MAO-B; Monoamine oxidase; Monoamine oxidase B; MAOB
|
||||
Target Type |
Successful
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | |||||
Central nervous system disease [ICD10: G00-G99] | |||||
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
Depression; Anxiety disorder [ICD9:311, 300; ICD10: F30-F39, F32, F40-F42] | |||||
Dementia [ICD9: 290-294; ICD10: F01-F07] | |||||
Idiopathic parkinson's disease [ICD9: 332; ICD10: F02.3, G20] | |||||
Major depressive episode without melancholia [ICD10: F30-F39] | |||||
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
Moderate to severe hypertension [ICD10: I10-I16] | |||||
Motor symptoms; Parkinson's disease [ICD9: 332, 335.2; ICD10: F02.3, G12.2, G20] | |||||
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32] | |||||
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
Obesity [ICD9: 278; ICD10: E66] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Vitiligo [ICD9: 709.01; ICD10: L80] | |||||
Unspecified [ICD code not available] | |||||
Function |
Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine.
|
||||
BioChemical Class |
Oxidoreductases acting on CH-NH2 group of donors
|
||||
Target Validation |
T83011
|
||||
UniProt ID | |||||
EC Number |
EC 1.4.3.4
|
||||
Sequence |
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV |
||||
Drugs and Mode of Action | |||||
Drug(s) | Indeloxazine | Drug Info | Approved | Dementia | [1] |
Pargyline | Drug Info | Approved | Moderate to severe hypertension | [1] | |
Phenelzine | Drug Info | Approved | Depression; Anxiety disorder | [2], [3], [1] | |
Rasagiline | Drug Info | Approved | Parkinson's disease | [4], [5] | |
Safinamide | Drug Info | Approved | Parkinson's disease | [6] | |
Selegiline | Drug Info | Approved | Major depressive disorder | [7], [8] | |
Selegiline Hydrochloride | Drug Info | Approved | Parkinson's disease | [1] | |
Tranylcypromine | Drug Info | Approved | Major depressive episode without melancholia | [1] | |
Psoralen | Drug Info | Phase 3 | Discovery agent | [9] | |
Safinamide | Drug Info | Phase 3 | Idiopathic parkinson's disease | [10], [11] | |
TRYPTAMINE | Drug Info | Phase 3 | Discovery agent | [12], [13] | |
P2B-001 | Drug Info | Phase 2/3 | Parkinson's disease | [14] | |
CHF-3381 | Drug Info | Phase 2 | Neuropathic pain | [15], [16] | |
Ladostigil | Drug Info | Phase 2 | Alzheimer disease | [17] | |
RG1577 | Drug Info | Phase 2 | Alzheimer disease | [18] | |
Neu-120 | Drug Info | Phase 1/2 | Parkinson's disease | [19] | |
PIPERINE | Drug Info | Phase 1/2 | Vitiligo | [20], [21] | |
PF9601N | Drug Info | Phase 1 | Parkinson's disease | [22] | |
RWJ-416457 | Drug Info | Preclinical | Bacterial infections | [23] | |
Lazabemide | Drug Info | Discontinued in Phase 3 | Cognitive disorders | [24], [25] | |
MOFEGILINE | Drug Info | Discontinued in Phase 3 | Cognitive disorders | [26] | |
EVT-301 | Drug Info | Discontinued in Phase 1 | Alzheimer disease | [27] | |
HT-1067 | Drug Info | Discontinued in Phase 1 | Parkinson's disease | [28] | |
SL-25.1188 | Drug Info | Discontinued in Phase 1 | Alzheimer disease | [29] | |
Milacemide | Drug Info | Terminated | Alzheimer disease | [30] | |
Inhibitor | (+/-)-2-(4'-Benzyloxyphenyl)thiomorpholin-5-one | Drug Info | [31] | ||
(+/-)-2-(4'-Benzyloxyphenyl)thiomorpholine | Drug Info | [31] | |||
(+/-)-2-(4'-Butoxyphenyl)thiomorpholin-5-one | Drug Info | [31] | |||
(+/-)-2-(4'-Butoxyphenyl)thiomorpholine | Drug Info | [31] | |||
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholin-5-one | Drug Info | [31] | |||
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholine | Drug Info | [31] | |||
(+/-)-2-(4'-Methoxyphenyl)thiomorpholin-5-one | Drug Info | [31] | |||
(+/-)-2-(4'-Methoxyphenyl)thiomorpholine | Drug Info | [31] | |||
(+/-)-2-(4'-Propoxyphenyl)thiomorpholin-5-one | Drug Info | [31] | |||
(+/-)-2-(4'-Propoxyphenyl)thiomorpholine | Drug Info | [31] | |||
(+/-)-2-(4-fluorophenyl)-7-methoxychroman-4-one | Drug Info | [32] | |||
(+/-)-2-(4-fluorophenyl)-7-methylchroman-4-one | Drug Info | [32] | |||
(+/-)-2-(4-fluorophenyl)chroman-4-one | Drug Info | [32] | |||
(+/-)-2-(4-methoxyphenyl)-7-methylchroman-4-one | Drug Info | [32] | |||
(+/-)-2-p-tolylchroman-4-one | Drug Info | [32] | |||
(+/-)-2-Phenylthiomorpholin-5-one | Drug Info | [31] | |||
(+/-)-2-Phenylthiomorpholine | Drug Info | [31] | |||
(+/-)-7-fluoro-2-(4-fluorophenyl)chroman-4-one | Drug Info | [32] | |||
(+/-)-7-fluoro-2-(4-methoxyphenyl)chroman-4-one | Drug Info | [32] | |||
(+/-)-7-fluoro-2-p-tolylchroman-4-one | Drug Info | [32] | |||
(+/-)-7-fluoro-2-phenylchroman-4-one | Drug Info | [32] | |||
(+/-)-7-methoxy-2-(4-methoxyphenyl)chroman-4-one | Drug Info | [32] | |||
(+/-)-7-methoxy-2-p-tolylchroman-4-one | Drug Info | [32] | |||
(+/-)-7-methoxy-2-phenylchroman-4-one | Drug Info | [32] | |||
(+/-)-7-methyl-2-p-tolylchroman-4-one | Drug Info | [32] | |||
(+/-)-7-methyl-2-phenylchroman-4-one | Drug Info | [32] | |||
(6-Benzyloxy-2-naphthyl)-2-aminopropane | Drug Info | [33] | |||
(6-Ethoxy-2-naphthyl)-2-aminopropane | Drug Info | [33] | |||
(6-Methoxy-2-naphthyl)-2-aminopropane | Drug Info | [33] | |||
(6-Propoxy-2-naphthyl)-2-aminopropane | Drug Info | [33] | |||
(7-Benzyloxy-2-oxo-2H-chromen-4-yl)acetonitrile | Drug Info | [34] | |||
(E)-5-(3-Chlorostyryl)isatin | Drug Info | [35] | |||
(E)-5-(3-Fluorostyryl)isatin | Drug Info | [35] | |||
(E)-5-Styrylisatin | Drug Info | [35] | |||
(E)-6-Styrylisatin | Drug Info | [35] | |||
(E)-8-(3-chlorostyryl)-caffeine | Drug Info | [36] | |||
(R)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one | Drug Info | [32] | |||
(R)(+)-7-fluoro-2-(4-fluorophenyl)chroman-4-one | Drug Info | [32] | |||
(R)(+)-7-fluoro-2-p-tolylchroman-4-one | Drug Info | [32] | |||
(R)(+)-7-fluoro-2-phenylchroman-4-one | Drug Info | [32] | |||
(R)(+)-7-methyl-2-p-tolylchroman-4-one | Drug Info | [32] | |||
(R)(+)-7-methyl-2-phenylchroman-4-one | Drug Info | [32] | |||
(R)-3-Prop-2-ynylamino-indan-5-ol | Drug Info | [37] | |||
(R)-Indan-1-yl-methyl-prop-2-ynyl-amine | Drug Info | [37] | |||
(R)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}alaninamide | Drug Info | [38] | |||
(R)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}serinamide | Drug Info | [38] | |||
(R)-N2-{4-[(3-fluorobenzyl)oxy]benzyl}alaninamide | Drug Info | [38] | |||
(R/R)BEFLOXATONE | Drug Info | [39] | |||
(S)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one | Drug Info | [32] | |||
(S)(+)-7-fluoro-2-(4-fluorophenyl)chroman-4-one | Drug Info | [32] | |||
(S)(+)-7-fluoro-2-p-tolylchroman-4-one | Drug Info | [32] | |||
(S)(+)-7-fluoro-2-phenylchroman-4-one | Drug Info | [32] | |||
(S)(+)-7-methyl-2-p-tolylchroman-4-one | Drug Info | [32] | |||
(S)(+)-7-methyl-2-phenylchroman-4-one | Drug Info | [32] | |||
(S)-2-amino-1-(4-butylthiophenyl)-propane | Drug Info | [40] | |||
(S)-2-amino-1-(4-propylthiophenyl)-propane | Drug Info | [40] | |||
(S)-N2-[4-(benzyloxy)benzyl]alaninamide | Drug Info | [38] | |||
(S)-N2-[4-(benzyloxy)benzyl]serinamide | Drug Info | [38] | |||
(S)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}alaninamide | Drug Info | [38] | |||
(S)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}serinamide | Drug Info | [38] | |||
(S)-N2-{4-[(3-fluorobenzyl)oxy]benzyl}serinamide | Drug Info | [38] | |||
(S)-N2-{4-[(4-chlorobenzyl)oxy]benzyl}alaninamide | Drug Info | [38] | |||
(S)-N2-{4-[(4-chlorobenzyl)oxy]benzyl}serinamide | Drug Info | [38] | |||
(S)-N2-{4-[(4-nitrobenzyl)oxy]benzyl}serinamide | Drug Info | [38] | |||
1,2,3,4-Tetrahydro-naphthalen-1-ylamine | Drug Info | [41] | |||
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole | Drug Info | [42] | |||
1,4-diphenyl-(1E,3E)-1,3-butadiene | Drug Info | [37] | |||
1-(4-(benzyloxy)phenyl)propan-2-amine | Drug Info | [33] | |||
1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine | Drug Info | [43] | |||
1H-Indole-2,3-dione | Drug Info | [37] | |||
2,3,4,5-Tetrahydro-1H-pyrido[4,3-b]indole | Drug Info | [44] | |||
2-(2,4-dichlorophenyl)-4,5-dihydro-1H-imidazole | Drug Info | [45] | |||
2-(2-cycloheptylidenehydrazinyl)-4-phenylthiazole | Drug Info | [46] | |||
2-(2-cyclohexylidenehydrazinyl)-4-p-tolylthiazole | Drug Info | [46] | |||
2-(2-cyclohexylidenehydrazinyl)-4-phenylthiazole | Drug Info | [46] | |||
2-(2-cyclopentylidenehydrazinyl)-4-phenylthiazole | Drug Info | [46] | |||
2-(3-nitrophenyl)-4,5-dihydro-1H-imidazole | Drug Info | [45] | |||
2-(4,5-dihydro-1H-imidazol-2-yl)quinoline | Drug Info | [45] | |||
2-(4-chlorophenyl)-4,5-dihydro-1H-imidazole | Drug Info | [45] | |||
2-(4-fluorophenyl)-7-methoxy-4H-chromen-4-one | Drug Info | [32] | |||
2-(4-methoxyphenyl)-4H-chromene-4-thione | Drug Info | [32] | |||
2-(5-phenyl-furan-2-yl)-4,5-dihydro-1H-imidazole | Drug Info | [47] | |||
2-(naphthalen-2-yl)-4,5-dihydro-1H-imidazole | Drug Info | [45] | |||
2-BFi | Drug Info | [45] | |||
2-Bromo-N-(2-morpholinoethyl)nicotinamide | Drug Info | [48] | |||
2-Bromo-N-(3-morpholinopropyl)nicotinamide | Drug Info | [48] | |||
2-Chloro-N-(2-morpholinoethyl)nicotinamide | Drug Info | [48] | |||
2-Chloro-N-(3-morpholinopropyl)nicotinamide | Drug Info | [48] | |||
2-Furan-2-yl-4,5-dihydro-1H-imidazole | Drug Info | [49] | |||
2-Hydrazino-3-methyl-4(3H)-quinazolinone | Drug Info | [50] | |||
2-methyl-9H-indeno[2,1-d]pyrimidin-9-one | Drug Info | [51] | |||
2-oxo-N-m-tolyl-2H-chromene-3-carboxamide | Drug Info | [52] | |||
2-oxo-N-p-tolyl-2H-chromene-3-carboxamide | Drug Info | [52] | |||
2-oxo-N-phenyl-2H-chromene-3-carboxamide | Drug Info | [52] | |||
2-p-tolyl-4,5-dihydro-1H-imidazole | Drug Info | [45] | |||
2-p-tolyl-4H-chromen-4-one | Drug Info | [32] | |||
2-p-tolyl-4H-chromene-4-thione | Drug Info | [32] | |||
2-Phenethyl-4,5-dihydro-1H-imidazole | Drug Info | [49] | |||
2-Phenoxymethyl-4,5-dihydro-1H-imidazole | Drug Info | [49] | |||
2-phenyl-9H-indeno[2,1-d]pyrimidine | Drug Info | [51] | |||
2-Phenyl-cyclopropylamine hydrochloride | Drug Info | [53] | |||
2-[7-(Benzyloxy)-2-oxo-2H-chromen-4-yl]acetamide | Drug Info | [34] | |||
3,4-Benzo-7-(beta-bromoallyloxy)-8-methylcoumarin | Drug Info | [54] | |||
3,4-Benzo-7-acetonyloxy-8-methoxycoumarin | Drug Info | [54] | |||
3,4-Dichloro-N-(2-methyl-1H-indol-5-yl)benzamide | Drug Info | [55] | |||
3-(2-Bromophenyl)-6-methylcoumarin | Drug Info | [56] | |||
3-(3-methoxyphenyl)-6-methyl-2H-chromen-2-one | Drug Info | [57] | |||
3-(4-hydroxyphenyl)-6-methyl-2H-chromen-2-one | Drug Info | [57] | |||
3-(4-methoxyphenyl)-6-methyl-2H-chromen-2-one | Drug Info | [57] | |||
3-(phenoxymethyl)-5H-indeno[1,2-c]pyridazin-5-one | Drug Info | [51] | |||
3-Chloro-N-(2-methyl-1H-indol-5-yl)benzamide | Drug Info | [55] | |||
3-phenyl-9H-indeno[1,2-e][1,2,4]triazin-9-one | Drug Info | [51] | |||
4,8-Dimethyl-7-(2'-oxocyclohexyloxy)coumarin | Drug Info | [54] | |||
4,9-Dihydro-3H-beta-carboline | Drug Info | [42] | |||
4-(2-oxo-2H-chromene-3-carboxamido)benzoic acid | Drug Info | [52] | |||
4-(Aminomethyl)-7-(benzyloxy)-2H-chromen-2-one | Drug Info | [34] | |||
4-HYDROXY-N-PROPARGYL-1(R)-AMINOINDAN | Drug Info | [58] | |||
4-methyl-7-(2-oxocyclopentyloxy)-2H-chromen-2-one | Drug Info | [54] | |||
4-oxo-4H-chromene-3-carboxylic acid | Drug Info | [59] | |||
4-phenyl-1,2,3,6-tetrahydropyridine | Drug Info | [43] | |||
5-Aminomethyl-3-pyrrol-1-yl-oxazolidin-2-one | Drug Info | [39] | |||
5-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [44] | |||
5-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [44] | |||
5-Hydroxy-N-Propargyl-1(R)-Aminoindan | Drug Info | [58] | |||
5-Hydroxymethyl-3-pyrrol-1-yl-oxazolidin-2-one | Drug Info | [39] | |||
5-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [44] | |||
5-Methoxy-4,9-dihydro-3H-beta-carboline | Drug Info | [44] | |||
6-amino-9-methoxy-7H-furo[3,2-g]chromen-7-one | Drug Info | [54] | |||
6-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [44] | |||
6-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [44] | |||
6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [42] | |||
6-Methoxy-4,9-dihydro-3H-beta-carboline | Drug Info | [42] | |||
7-(3-chlorobenzyloxy)-4-carboxaldehyde-coumarin | Drug Info | [60] | |||
7-Acetonyloxy-3,4-cyclohexene-8-methylcoumarin | Drug Info | [54] | |||
7-Acetonyloxy-3,4-cyclopentene-8-methylcoumarin | Drug Info | [54] | |||
7-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [44] | |||
7-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [44] | |||
7-fluoro-2-(4-fluorophenyl)-4H-chromene-4-thione | Drug Info | [32] | |||
7-fluoro-2-(4-methoxyphenyl)-4H-chromen-4-one | Drug Info | [32] | |||
7-fluoro-2-p-tolyl-4H-chromen-4-one | Drug Info | [32] | |||
7-fluoro-2-p-tolyl-4H-chromene-4-thione | Drug Info | [32] | |||
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [49] | |||
7-methoxy-2-p-tolyl-4H-chromen-4-one | Drug Info | [32] | |||
7-methoxy-2-p-tolyl-4H-chromene-4-thione | Drug Info | [32] | |||
7-Methoxy-9H-beta-carboline | Drug Info | [44] | |||
7-methyl-2-p-tolyl-4H-chromene-4-thione | Drug Info | [32] | |||
8-(3-Bromobenzyloxy)caffeine | Drug Info | [61] | |||
8-(3-Chlorobenzyloxy)caffeine | Drug Info | [61] | |||
8-(3-Fluorobenzyloxy)caffeine | Drug Info | [61] | |||
8-(3-Methoxybenzyloxy)caffeine | Drug Info | [61] | |||
8-(3-Methylbenzyloxy)caffeine | Drug Info | [61] | |||
8-Benzyloxycaffeine | Drug Info | [61] | |||
8-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [44] | |||
8-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [44] | |||
8-Bromo-6-methyl-3-(4'-methoxyphenyl)coumarin | Drug Info | [56] | |||
8-Bromo-6-methyl-3-phenylcoumarin | Drug Info | [56] | |||
8-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [44] | |||
8-Methoxy-4,9-dihydro-3H-beta-carboline | Drug Info | [44] | |||
8-[(3-Trifluoromethyl)benzyloxy]caffeine | Drug Info | [61] | |||
9-Methyl-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [44] | |||
AS-605240 | Drug Info | [62] | |||
Benzyl-methyl-[1-(1H-pyrrol-2-yl)-vinyl]-amine | Drug Info | [63] | |||
Butyl-methyl-prop-2-ynyl-amine hydrochloride | Drug Info | [64] | |||
C-(1H-Indol-3-yl)-methylamine | Drug Info | [44] | |||
CGS-19281A | Drug Info | [42] | |||
CHALCONE | Drug Info | [65] | |||
CHF-3381 | Drug Info | [16] | |||
Cis-2-(4-chlorophenyl)-2-fluorocyclopropanamine | Drug Info | [66] | |||
Cis-2-(para-fluorophenyl)cyclopropylamine | Drug Info | [66] | |||
Cis-2-Fluoro-2-(4-methoxyphenyl)cyclopropylamine | Drug Info | [66] | |||
Cis-2-fluoro-2-phenylcyclopropanamine | Drug Info | [66] | |||
Cis-2-phenylcyclopropylamine | Drug Info | [66] | |||
CORDOIN | Drug Info | [65] | |||
Deprenyl | Drug Info | [67] | |||
EVT-301 | Drug Info | [68] | |||
Farnesol | Drug Info | [58] | |||
Flavin-Adenine Dinucleotide | Drug Info | [69] | |||
Heptyl-methyl-prop-2-ynyl-amine hydrochloride | Drug Info | [64] | |||
HT-1067 | Drug Info | [70] | |||
HYDRAZINECARBOXAMIDE | Drug Info | [53] | |||
IPRONIAZIDE | Drug Info | [48] | |||
Isatin | Drug Info | [71] | |||
Isopropyl-methyl-prop-2-ynyl-amine hydrochloride | Drug Info | [64] | |||
Isopsoralen | Drug Info | [72] | |||
JD-0100 | Drug Info | [73] | |||
L-136662 | Drug Info | [62] | |||
Ladostigil | Drug Info | [17] | |||
Lauryl Dimethylamine-N-Oxide | Drug Info | [69] | |||
Lazabemide | Drug Info | [74] | |||
LAZEBEMIDE | Drug Info | [37] | |||
Methyl piperate | Drug Info | [75] | |||
Methyl-(1,2,3,4-tetrahydro-naphthalen-1-yl)-amine | Drug Info | [41] | |||
Methyl-pentyl-prop-2-ynyl-amine oxalic acid | Drug Info | [64] | |||
N-(1H-Indol-2-ylmethyl)-N-methyl-N-phenylamine | Drug Info | [76] | |||
N-(1H-Indol-2-ylmethyl)-N-phenylamine | Drug Info | [76] | |||
N-(2-aminoethyl)-2-oxo-2H-chromene-3-carboxamide | Drug Info | [52] | |||
N-(2-AMINOETHYL)-P-CHLOROBENZAMIDE | Drug Info | [58] | |||
N-(2-Methyl-1H-indol-5-yl)benzamide | Drug Info | [55] | |||
N-(2-Methyl-1H-indol-5-yl)cyclohexanecarboxamide | Drug Info | [55] | |||
N-(2-phenylethyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [77] | |||
N-(2-Phenylethyl)-1H-indole-2-carboxamide | Drug Info | [76] | |||
N-(3-Phenylpropyl)-1H-indole-2-carboxamide | Drug Info | [76] | |||
N-(4-Ethylphenyl)-2-oxo-2H-chromene-3-carboxamide | Drug Info | [52] | |||
N-(4-Phenylbutyl)-1H-indole-2-carboxamide | Drug Info | [76] | |||
N-(benzyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [77] | |||
N-(propargyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [77] | |||
N-Benzyl,N-methyl-1H-indole-2-carboxamide | Drug Info | [76] | |||
N-Benzyl-1H-indole-2-carboxamide | Drug Info | [76] | |||
N-benzyl-2-oxo-2H-chromene-3-carboxamide | Drug Info | [52] | |||
N-Benzyl-N-(1H-indol-2-ylmethyl)-N-methylamine | Drug Info | [76] | |||
N-cyclohexyl-2-oxo-2H-chromene-3-carboxamide | Drug Info | [52] | |||
N-isobutyl-2-oxo-2H-chromene-3-carboxamide | Drug Info | [52] | |||
N-methyl,N-(benzyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [77] | |||
N-methyl,N-(propargyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [77] | |||
N-Methyl,N-phenyl-1H-indole-2-carboxamide | Drug Info | [76] | |||
N-Methyl-N-phenyl-2-oxo-2H-chromene-3-carboxamide | Drug Info | [52] | |||
N-Methyl-N-Propargyl-1(R)-Aminoindan | Drug Info | [58] | |||
N-Phenyl-1H-indole-2-carboxamide | Drug Info | [76] | |||
N-Propargyl-1(S)-Aminoindan | Drug Info | [58] | |||
N2-[4-(benzyloxy)benzyl]glycinamide | Drug Info | [38] | |||
N2-{4-[(3-chlorobenzyl)oxy]benzyl}glycinamide | Drug Info | [38] | |||
N2-{4-[(3-fluorobenzyl)oxy]benzyl}glycinamide | Drug Info | [38] | |||
N2-{4-[(4-chlorobenzyl)oxy]benzyl}glycinamide | Drug Info | [38] | |||
N2-{4-[(4-nitrobenzyl)oxy]benzyl}glycinamide | Drug Info | [38] | |||
NSC-50187 | Drug Info | [32] | |||
NSC-50393 | Drug Info | [32] | |||
NSC-93405 | Drug Info | [32] | |||
NW-1772 | Drug Info | [73] | |||
P2B-001 | Drug Info | [78] | |||
Pargyline | Drug Info | [79] | |||
PF9601N | Drug Info | [10] | |||
Phenelzine | Drug Info | [80] | |||
Phenyl 4-(4,5-dihydro-1H-imidazol-2-yl)benzoate | Drug Info | [45] | |||
PIPERINE | Drug Info | [75] | |||
PNU-22394 | Drug Info | [44] | |||
Psoralen | Drug Info | [72] | |||
Rasagiline | Drug Info | [81] | |||
RS-1636 | Drug Info | [82] | |||
RS-1653 | Drug Info | [82] | |||
RWJ-416457 | Drug Info | [73] | |||
Safinamide | Drug Info | [83], [84] | |||
Selegiline | Drug Info | [73] | |||
SKL-PD | Drug Info | [73] | |||
SL-25.1188 | Drug Info | [85] | |||
TOLOXATONE | Drug Info | [39] | |||
TRACIZOLINE | Drug Info | [49] | |||
Trans-2-(4-chlorophenyl)-2-fluorocyclopropanamine | Drug Info | [66] | |||
Trans-2-fluoro-2-(4-fluorophenyl)cyclopropanamine | Drug Info | [66] | |||
Trans-2-fluoro-2-p-tolylcyclopropanamine | Drug Info | [66] | |||
Trans-2-fluoro-2-phenylcyclopropylamin | Drug Info | [66] | |||
Tranylcypromine | Drug Info | [86], [87] | |||
TRYPTAMINE | Drug Info | [44] | |||
TRYPTOLINE | Drug Info | [49] | |||
VAR-10300 | Drug Info | [73] | |||
Zydis selegiline | Drug Info | [83] | |||
[(1e)-4-Phenylbut-1-Enyl]Benzene | Drug Info | [58] | |||
Modulator | 4-fluoroselegiline | Drug Info | [88] | ||
Indeloxazine | Drug Info | [1] | |||
LU-53439 | Drug Info | ||||
Milacemide | Drug Info | [30] | |||
MOFEGILINE | Drug Info | [89] | |||
Neu-120 | Drug Info | ||||
RG1577 | Drug Info | [90] | |||
Selegiline Hydrochloride | Drug Info | [91] | |||
VAR-10200 | Drug Info | [73] | |||
Antagonist | 4-Methoxyamphetamine | Drug Info | [92] | ||
MMDA | Drug Info | [69] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Superpathway of tryptophan utilization | ||||
Tryptophan degradation via tryptamine | |||||
Dopamine degradation | |||||
Putrescine degradation III | |||||
Noradrenaline and adrenaline degradation | |||||
KEGG Pathway | Glycine, serine and threonine metabolism | ||||
Arginine and proline metabolism | |||||
Histidine metabolism | |||||
Tyrosine metabolism | |||||
Phenylalanine metabolism | |||||
Tryptophan metabolism | |||||
Drug metabolism - cytochrome P450 | |||||
Metabolic pathways | |||||
Serotonergic synapse | |||||
Dopaminergic synapse | |||||
Cocaine addiction | |||||
Amphetamine addiction | |||||
Alcoholism | |||||
PANTHER Pathway | Adrenaline and noradrenaline biosynthesis | ||||
5-Hydroxytryptamine degredation | |||||
Dopamine receptor mediated signaling pathway | |||||
Pathway Interaction Database | Alpha-synuclein signaling | ||||
WikiPathways | Tryptophan metabolism | ||||
Dopamine metabolism | |||||
Phase 1 - Functionalization of compounds | |||||
References | |||||
REF 1 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 2 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011909. | ||||
REF 3 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7266). | ||||
REF 4 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | ||||
REF 5 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6641). | ||||
REF 6 | Drugs@FDA (Edaravone) | ||||
REF 7 | ClinicalTrials.gov (NCT00640159) Tolerability and Efficacy of Switch From Oral Selegiline to Orally Disintegrating Selegiline (Zelapar) in Patients With Parkinson's Disease. U.S. National Institutes of Health. | ||||
REF 8 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6639). | ||||
REF 9 | ClinicalTrials.gov (NCT01686594) PUVA Maintenance Therapy in Mycosis Fungoides. U.S. National Institutes of Health. | ||||
REF 10 | Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. | ||||
REF 11 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8291). | ||||
REF 12 | ClinicalTrials.gov (NCT00227136) Effect of Oral 5-HTP Intake on Urinary 5-HIAA Excretion. U.S. National Institutes of Health. | ||||
REF 13 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 125). | ||||
REF 14 | ClinicalTrials.gov (NCT01968460) Safety, Tolerability and Efficacy of Two Doses of Once Daily P2B001 in Subjects With Early Parkinson's Disease. U.S. National Institutes of Health. | ||||
REF 15 | Indantadol, a novel NMDA antagonist and nonselective MAO inhibitor for the potential treatment of neuropathic pain. IDrugs. 2007 Sep;10(9):636-44. | ||||
REF 16 | Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26. | ||||
REF 17 | Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94. | ||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026046) | ||||
REF 19 | ClinicalTrials.gov (NCT00607451) Safety, Tolerability, PK and PD Study of Neu-120 in the Treatment of Levodopa-induced Dyskinesia. U.S. National Institutes of Health. | ||||
REF 20 | ClinicalTrials.gov (NCT01383694) Effect Of Piperine In Patients With Oropharyngeal Dysphagia. U.S. National Institutes of Health. | ||||
REF 21 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2489). | ||||
REF 22 | CYP-dependent metabolism of PF9601N, a new monoamine oxidase-B inhibitor, by C57BL/6 mouse and human liver microsomes. J Pharm Pharm Sci. 2007;10(4):473-85. | ||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016773) | ||||
REF 24 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6640). | ||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004032) | ||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002656) | ||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024230) | ||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034020) | ||||
REF 29 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012921) | ||||
REF 30 | Milacemide, the selective substrate and enzyme-activated specific inhibitor of monoamine oxidase B, increases dopamine but not serotonin in caudate nucleus of rhesus monkey. Neurochem Int. 1990;17(2):325-9. | ||||
REF 31 | Bioorg Med Chem. 2010 Feb 15;18(4):1388-95. Epub 2010 Jan 15.2-Arylthiomorpholine derivatives as potent and selective monoamine oxidase B inhibitors. | ||||
REF 32 | Bioorg Med Chem. 2010 Feb;18(3):1273-9. Epub 2010 Jan 4.A new series of flavones, thioflavones, and flavanones as selective monoamine oxidase-B inhibitors. | ||||
REF 33 | Bioorg Med Chem. 2009 Mar 15;17(6):2452-60. Epub 2009 Feb 8.Naphthylisopropylamine and N-benzylamphetamine derivatives as monoamine oxidase inhibitors. | ||||
REF 34 | J Med Chem. 2009 Nov 12;52(21):6685-706.Discovery of a novel class of potent coumarin monoamine oxidase B inhibitors: development and biopharmacological profiling of 7-[(3-chlorobenzyl)oxy]-4-[(methylamino)methyl]-2H-chromen-2-one methanesulfonate (NW-1772) as a highly potent, selective, reversible, and orally active monoamine oxidase B inhibitor. | ||||
REF 35 | Bioorg Med Chem Lett. 2009 May 1;19(9):2509-13. Epub 2009 Mar 14.Inhibition of monoamine oxidase by (E)-styrylisatin analogues. | ||||
REF 36 | Bioorg Med Chem. 2009 Nov 1;17(21):7523-30. Epub 2009 Sep 15.Synthesis and in vitro evaluation of pteridine analogues as monoamine oxidase B and nitric oxide synthase inhibitors. | ||||
REF 37 | Bioorg Med Chem Lett. 2005 Oct 15;15(20):4438-46.Docking studies on monoamine oxidase-B inhibitors: estimation of inhibition constants (K(i)) of a series of experimentally tested compounds. | ||||
REF 38 | J Med Chem. 2007 Oct 4;50(20):4909-16. Epub 2007 Sep 7.Solid-phase synthesis and insights into structure-activity relationships of safinamide analogues as potent and selective inhibitors of type B monoamine oxidase. | ||||
REF 39 | J Med Chem. 2002 Mar 14;45(6):1180-3.3-(1H-Pyrrol-1-yl)-2-oxazolidinones as reversible, highly potent, and selective inhibitors of monoamine oxidase type A. | ||||
REF 40 | Bioorg Med Chem. 2007 Aug 1;15(15):5198-206. Epub 2007 May 22.Human and rat monoamine oxidase-A are differentially inhibited by (S)-4-alkylthioamphetamine derivatives: insights from molecular modeling studies. | ||||
REF 41 | J Med Chem. 1988 Aug;31(8):1558-66.Stereoisomers of allenic amines as inactivators of monoamine oxidase type B. Stereochemical probes of the active site. | ||||
REF 42 | Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5.Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands. | ||||
REF 43 | Further explorations of unnatural alkaloids. J Nat Prod. 1985 Nov-Dec;48(6):878-93. | ||||
REF 44 | Bioorg Med Chem Lett. 2004 Feb 23;14(4):999-1002.Binding of beta-carbolines at imidazoline I2 receptors: a structure-affinity investigation. | ||||
REF 45 | Bioorg Med Chem Lett. 2009 Jan 15;19(2):546-9. Epub 2008 Mar 6.Ultrasound promoted synthesis of 2-imidazolines in water: a greener approach toward monoamine oxidase inhibitors. | ||||
REF 46 | Synthesis, semipreparative HPLC separation, biological evaluation, and 3D-QSAR of hydrazothiazole derivatives as human monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Jul 15;18(14):5063-70. doi: 10.1016/j.bmc.2010.05.070. Epub 2010 Jun 1. | ||||
REF 47 | J Med Chem. 2006 Sep 7;49(18):5578-86.3-[5-(4,5-dihydro-1H-imidazol-2-yl)-furan-2-yl]phenylamine (Amifuraline), a promising reversible and selective peripheral MAO-A inhibitor. | ||||
REF 48 | Bioorg Med Chem. 2010 Feb 15;18(4):1659-64. Epub 2010 Jan 4.Design of novel nicotinamides as potent and selective monoamine oxidase a inhibitors. | ||||
REF 49 | Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9.Binding of an imidazopyridoindole at imidazoline I2 receptors. | ||||
REF 50 | Bioorg Med Chem. 2009 Jan 15;17(2):675-89. Epub 2008 Dec 3.New pyrazoline bearing 4(3H)-quinazolinone inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity. | ||||
REF 51 | J Med Chem. 2007 Nov 1;50(22):5364-71. Epub 2007 Oct 2.Synthesis and monoamine oxidase inhibitory activity of new pyridazine-, pyrimidine- and 1,2,4-triazine-containing tricyclic derivatives. | ||||
REF 52 | J Med Chem. 2009 Apr 9;52(7):1935-42.Synthesis, molecular modeling, and selective inhibitory activity against human monoamine oxidases of 3-carboxamido-7-substituted coumarins. | ||||
REF 53 | J Med Chem. 2004 Nov 18;47(24):5860-71.Fluorinated phenylcyclopropylamines. 2. Effects of aromatic ring substitution and of absolute configuration on inhibition of microbial tyramine oxidase. | ||||
REF 54 | J Med Chem. 2008 Nov 13;51(21):6740-51. Epub 2008 Oct 4.Quantitative structure-activity relationship and complex network approach to monoamine oxidase A and B inhibitors. | ||||
REF 55 | Eur J Med Chem. 2010 Oct;45(10):4458-66. Epub 2010 Jul 31.Inhibition of monoamine oxidase by indole and benzofuran derivatives. | ||||
REF 56 | Bioorg Med Chem Lett. 2010 Sep 1;20(17):5157-60. Epub 2010 Jul 8.New halogenated 3-phenylcoumarins as potent and selective MAO-B inhibitors. | ||||
REF 57 | Bioorg Med Chem Lett. 2009 Sep 1;19(17):5053-5. Epub 2009 Jul 10.Synthesis and evaluation of 6-methyl-3-phenylcoumarins as potent and selective MAO-B inhibitors. | ||||
REF 58 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
REF 59 | Bioorg Med Chem Lett. 2010 May 1;20(9):2709-12. Epub 2010 Mar 27.Chromone-2- and -3-carboxylic acids inhibit differently monoamine oxidases A and B. | ||||
REF 60 | J Med Chem. 2007 Nov 15;50(23):5848-52. Epub 2007 Oct 4.Structures of human monoamine oxidase B complexes with selective noncovalent inhibitors: safinamide and coumarin analogs. | ||||
REF 61 | Bioorg Med Chem. 2010 Feb;18(3):1018-28. Epub 2010 Jan 6.Inhibition of monoamine oxidase by 8-benzyloxycaffeine analogues. | ||||
REF 62 | Bioorg Med Chem Lett. 2010 Sep 1;20(17):5295-8. Epub 2010 Jul 1.Identification of novel monoamine oxidase B inhibitors by structure-based virtual screening. | ||||
REF 63 | J Med Chem. 2003 Mar 13;46(6):917-20.Simple, potent, and selective pyrrole inhibitors of monoamine oxidase types A and B. | ||||
REF 64 | J Med Chem. 1992 Oct 2;35(20):3705-13.Aliphatic propargylamines: potent, selective, irreversible monoamine oxidase B inhibitors. | ||||
REF 65 | J Med Chem. 2009 May 14;52(9):2818-24.Chalcones: a valid scaffold for monoamine oxidases inhibitors. | ||||
REF 66 | Bioorg Med Chem. 2008 Aug 1;16(15):7148-66. Epub 2008 Jun 28.Fluorinated phenylcyclopropylamines. Part 5: Effects of electron-withdrawing or -donating aryl substituents on the inhibition of monoamine oxidases A and B by 2-aryl-2-fluoro-cyclopropylamines. | ||||
REF 67 | The effect of deprenyl washout in patients with long-standing Parkinson's disease. J Neural Transm. 2002 May;109(5-6):797-803. | ||||
REF 68 | Assessment of MAO-B occupancy in the brain with PET and [11C]-L-deprenyl-D2: a dose-finding study with a novel MAO-B inhibitor, EVT 301. Clin Pharmacol Ther. 2009 May;85(5):506-12. | ||||
REF 69 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 70 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034020) | ||||
REF 71 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January | ||||
REF 72 | Inhibition of rat brain monoamine oxidase activities by psoralen and isopsoralen: implications for the treatment of affective disorders. Pharmacol Toxicol. 2001 Feb;88(2):75-80. | ||||
REF 73 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2490). | ||||
REF 74 | The activity of MAO A and B in rat renal cells and tubules. Life Sci. 1998;62(8):727-37. | ||||
REF 75 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):537-40. Epub 2009 Nov 26.Proposed structural basis of interaction of piperine and related compounds with monoamine oxidases. | ||||
REF 76 | Bioorg Med Chem. 2008 Nov 15;16(22):9729-40. Epub 2008 Oct 2.Synthesis, structure-activity relationships and molecular modeling studies of new indole inhibitors of monoamine oxidases A and B. | ||||
REF 77 | J Med Chem. 2007 Mar 8;50(5):922-31. Epub 2007 Jan 26.New pyrrole inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity. | ||||
REF 78 | Rasagiline (TVP-1012): a new selective monoamine oxidase inhibitor for Parkinson's disease. Am J Geriatr Pharmacother. 2006 Dec;4(4):330-46. | ||||
REF 79 | Dose-dependent activation of distinct hypertrophic pathways by serotonin in cardiac cells. Am J Physiol Heart Circ Physiol. 2009 Aug;297(2):H821-8. Epub 2009 Jun 19. | ||||
REF 80 | Limitation of adipose tissue enlargement in rats chronically treated with semicarbazide-sensitive amine oxidase and monoamine oxidase inhibitors. Pharmacol Res. 2008 Jun;57(6):426-34. Epub 2008 Apr 24. | ||||
REF 81 | Glyceraldehyde-3-Phosphate Dehydrogenase-Monoamine Oxidase B-Mediated Cell Death-Induced by Ethanol is Prevented by Rasagiline and 1-R-Aminoindan. Neurotox Res. 2009 Aug;16(2):148-59. Epub 2009 May 28. | ||||
REF 82 | Novel monoamine oxidase inhibitors, 3-(2-aminoethoxy)-1,2-benzisoxazole derivatives, and their differential reversibility. Jpn J Pharmacol. 2002 Feb;88(2):174-82. | ||||
REF 83 | Emerging drugs for Parkinson's disease. Expert Opin Emerg Drugs. 2006 Sep;11(3):403-17. | ||||
REF 84 | Emerging drugs for epilepsy. Expert Opin Emerg Drugs. 2007 Sep;12(3):407-22. | ||||
REF 85 | [(11)C]SL25.1188, a new reversible radioligand to study the monoamine oxidase type B with PET: preclinical characterisation in nonhuman primate. Synapse. 2010 Jan;64(1):61-9. | ||||
REF 86 | Tranylcypromine: new perspectives on an "old" drug. Eur Arch Psychiatry Clin Neurosci. 2006 Aug;256(5):268-73. | ||||
REF 87 | Dopamine D2 receptors: a potential pharmacological target for nomifensine and tranylcypromine but not other antidepressant treatments. Pharmacol Biochem Behav. 1995 Aug;51(4):565-9. | ||||
REF 88 | Multiple, small dose administration of (-)deprenyl enhances catecholaminergic activity and diminishes serotoninergic activity in the brain and these effects are unrelated to MAO-B inhibition. Arch Int Pharmacodyn Ther. 1994 Jul-Aug;328(1):1-15. | ||||
REF 89 | J Med Chem. 2008 Dec 25;51(24):8019-26.Structural and mechanistic studies of mofegiline inhibition of recombinant human monoamine oxidase B. | ||||
REF 90 | Sembragiline Alzheimer's Disease (Phase 2). Evotech AG, Roche. | ||||
REF 91 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | ||||
REF 92 | Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.