Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T83011
|
||||
Former ID |
TTDS00341
|
||||
Target Name |
Amine oxidase [flavin-containing] B
|
||||
Gene Name |
MAOB
|
||||
Synonyms |
MAO-B; Monoamine oxidase; Monoamine oxidase B; MAOB
|
||||
Target Type |
Successful
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | |||||
Central nervous system disease [ICD10: G00-G99] | |||||
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3] | |||||
Depression; Anxiety disorder [ICD9:311, 300; ICD10: F30-F39, F32, F40-F42] | |||||
Dementia [ICD9: 290-294; ICD10: F01-F07] | |||||
Idiopathic parkinson's disease [ICD9: 332; ICD10: F02.3, G20] | |||||
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32] | |||||
Moderate to severe hypertension [ICD10: I10-I16] | |||||
Motor symptoms; Parkinson's disease [ICD9: 332, 335.2; ICD10: F02.3, G12.2, G20] | |||||
Major depressive episode without melancholia [ICD10: F30-F39] | |||||
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32] | |||||
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
Obesity [ICD9: 278; ICD10: E66] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Vitiligo [ICD9: 709.01; ICD10: L80] | |||||
Unspecified [ICD code not available] | |||||
Function |
Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine.
|
||||
BioChemical Class |
Oxidoreductases acting on CH-NH2 group of donors
|
||||
Target Validation |
T83011
|
||||
UniProt ID | |||||
EC Number |
EC 1.4.3.4
|
||||
Sequence |
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV |
||||
Drugs and Mode of Action | |||||
Drug(s) | Indeloxazine | Drug Info | Approved | Dementia | [551871] |
Pargyline | Drug Info | Approved | Moderate to severe hypertension | [551871] | |
Phenelzine | Drug Info | Approved | Depression; Anxiety disorder | [538452], [542285], [551871] | |
Rasagiline | Drug Info | Approved | Parkinson's disease | [536285], [541751] | |
Safinamide | Drug Info | Approved | Parkinson's disease | [889446] | |
Selegiline | Drug Info | Approved | Major depressive disorder | [522265], [541748] | |
Selegiline Hydrochloride | Drug Info | Approved | Parkinson's disease | [551871] | |
Tranylcypromine | Drug Info | Approved | Major depressive episode without melancholia | [551871] | |
Psoralen | Drug Info | Phase 3 | Discovery agent | [524054] | |
Safinamide | Drug Info | Phase 3 | Idiopathic parkinson's disease | [536923], [543044] | |
TRYPTAMINE | Drug Info | Phase 3 | Discovery agent | [521730], [538764] | |
P2B-001 | Drug Info | Phase 2/3 | Parkinson's disease | [524487] | |
CHF-3381 | Drug Info | Phase 2 | Neuropathic pain | [529017], [536374] | |
Ladostigil | Drug Info | Phase 2 | Alzheimer disease | [531772] | |
RG1577 | Drug Info | Phase 2 | Alzheimer disease | [548499] | |
Neu-120 | Drug Info | Phase 1/2 | Parkinson's disease | [522217] | |
PIPERINE | Drug Info | Phase 1/2 | Vitiligo | [523529], [539613] | |
PF9601N | Drug Info | Phase 1 | Parkinson's disease | [529304] | |
RWJ-416457 | Drug Info | Preclinical | Bacterial infections | [547487] | |
Lazabemide | Drug Info | Discontinued in Phase 3 | Cognitive disorders | [541750], [545650] | |
MOFEGILINE | Drug Info | Discontinued in Phase 3 | Cognitive disorders | [545271] | |
EVT-301 | Drug Info | Discontinued in Phase 1 | Alzheimer disease | [548293] | |
HT-1067 | Drug Info | Discontinued in Phase 1 | Parkinson's disease | [549231] | |
SL-25.1188 | Drug Info | Discontinued in Phase 1 | Alzheimer disease | [547083] | |
Milacemide | Drug Info | Terminated | Alzheimer disease | [530942] | |
Inhibitor | (+/-)-2-(4'-Benzyloxyphenyl)thiomorpholin-5-one | Drug Info | [530683] | ||
(+/-)-2-(4'-Benzyloxyphenyl)thiomorpholine | Drug Info | [530683] | |||
(+/-)-2-(4'-Butoxyphenyl)thiomorpholin-5-one | Drug Info | [530683] | |||
(+/-)-2-(4'-Butoxyphenyl)thiomorpholine | Drug Info | [530683] | |||
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholin-5-one | Drug Info | [530683] | |||
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholine | Drug Info | [530683] | |||
(+/-)-2-(4'-Methoxyphenyl)thiomorpholin-5-one | Drug Info | [530683] | |||
(+/-)-2-(4'-Methoxyphenyl)thiomorpholine | Drug Info | [530683] | |||
(+/-)-2-(4'-Propoxyphenyl)thiomorpholin-5-one | Drug Info | [530683] | |||
(+/-)-2-(4'-Propoxyphenyl)thiomorpholine | Drug Info | [530683] | |||
(+/-)-2-(4-fluorophenyl)-7-methoxychroman-4-one | Drug Info | [530614] | |||
(+/-)-2-(4-fluorophenyl)-7-methylchroman-4-one | Drug Info | [530614] | |||
(+/-)-2-(4-fluorophenyl)chroman-4-one | Drug Info | [530614] | |||
(+/-)-2-(4-methoxyphenyl)-7-methylchroman-4-one | Drug Info | [530614] | |||
(+/-)-2-p-tolylchroman-4-one | Drug Info | [530614] | |||
(+/-)-2-Phenylthiomorpholin-5-one | Drug Info | [530683] | |||
(+/-)-2-Phenylthiomorpholine | Drug Info | [530683] | |||
(+/-)-7-fluoro-2-(4-fluorophenyl)chroman-4-one | Drug Info | [530614] | |||
(+/-)-7-fluoro-2-(4-methoxyphenyl)chroman-4-one | Drug Info | [530614] | |||
(+/-)-7-fluoro-2-p-tolylchroman-4-one | Drug Info | [530614] | |||
(+/-)-7-fluoro-2-phenylchroman-4-one | Drug Info | [530614] | |||
(+/-)-7-methoxy-2-(4-methoxyphenyl)chroman-4-one | Drug Info | [530614] | |||
(+/-)-7-methoxy-2-p-tolylchroman-4-one | Drug Info | [530614] | |||
(+/-)-7-methoxy-2-phenylchroman-4-one | Drug Info | [530614] | |||
(+/-)-7-methyl-2-p-tolylchroman-4-one | Drug Info | [530614] | |||
(+/-)-7-methyl-2-phenylchroman-4-one | Drug Info | [530614] | |||
(6-Benzyloxy-2-naphthyl)-2-aminopropane | Drug Info | [529986] | |||
(6-Ethoxy-2-naphthyl)-2-aminopropane | Drug Info | [529986] | |||
(6-Methoxy-2-naphthyl)-2-aminopropane | Drug Info | [529986] | |||
(6-Propoxy-2-naphthyl)-2-aminopropane | Drug Info | [529986] | |||
(7-Benzyloxy-2-oxo-2H-chromen-4-yl)acetonitrile | Drug Info | [530434] | |||
(E)-5-(3-Chlorostyryl)isatin | Drug Info | [530056] | |||
(E)-5-(3-Fluorostyryl)isatin | Drug Info | [530056] | |||
(E)-5-Styrylisatin | Drug Info | [530056] | |||
(E)-6-Styrylisatin | Drug Info | [530056] | |||
(E)-8-(3-chlorostyryl)-caffeine | Drug Info | [530425] | |||
(R)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one | Drug Info | [530614] | |||
(R)(+)-7-fluoro-2-(4-fluorophenyl)chroman-4-one | Drug Info | [530614] | |||
(R)(+)-7-fluoro-2-p-tolylchroman-4-one | Drug Info | [530614] | |||
(R)(+)-7-fluoro-2-phenylchroman-4-one | Drug Info | [530614] | |||
(R)(+)-7-methyl-2-p-tolylchroman-4-one | Drug Info | [530614] | |||
(R)(+)-7-methyl-2-phenylchroman-4-one | Drug Info | [530614] | |||
(R)-3-Prop-2-ynylamino-indan-5-ol | Drug Info | [527719] | |||
(R)-Indan-1-yl-methyl-prop-2-ynyl-amine | Drug Info | [527719] | |||
(R)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}alaninamide | Drug Info | [529025] | |||
(R)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}serinamide | Drug Info | [529025] | |||
(R)-N2-{4-[(3-fluorobenzyl)oxy]benzyl}alaninamide | Drug Info | [529025] | |||
(R/R)BEFLOXATONE | Drug Info | [526287] | |||
(S)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one | Drug Info | [530614] | |||
(S)(+)-7-fluoro-2-(4-fluorophenyl)chroman-4-one | Drug Info | [530614] | |||
(S)(+)-7-fluoro-2-p-tolylchroman-4-one | Drug Info | [530614] | |||
(S)(+)-7-fluoro-2-phenylchroman-4-one | Drug Info | [530614] | |||
(S)(+)-7-methyl-2-p-tolylchroman-4-one | Drug Info | [530614] | |||
(S)(+)-7-methyl-2-phenylchroman-4-one | Drug Info | [530614] | |||
(S)-2-amino-1-(4-butylthiophenyl)-propane | Drug Info | [528855] | |||
(S)-2-amino-1-(4-propylthiophenyl)-propane | Drug Info | [528855] | |||
(S)-N2-[4-(benzyloxy)benzyl]alaninamide | Drug Info | [529025] | |||
(S)-N2-[4-(benzyloxy)benzyl]serinamide | Drug Info | [529025] | |||
(S)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}alaninamide | Drug Info | [529025] | |||
(S)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}serinamide | Drug Info | [529025] | |||
(S)-N2-{4-[(3-fluorobenzyl)oxy]benzyl}serinamide | Drug Info | [529025] | |||
(S)-N2-{4-[(4-chlorobenzyl)oxy]benzyl}alaninamide | Drug Info | [529025] | |||
(S)-N2-{4-[(4-chlorobenzyl)oxy]benzyl}serinamide | Drug Info | [529025] | |||
(S)-N2-{4-[(4-nitrobenzyl)oxy]benzyl}serinamide | Drug Info | [529025] | |||
1,2,3,4-Tetrahydro-naphthalen-1-ylamine | Drug Info | [533451] | |||
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole | Drug Info | [526994] | |||
1,4-diphenyl-(1E,3E)-1,3-butadiene | Drug Info | [527719] | |||
1-(4-(benzyloxy)phenyl)propan-2-amine | Drug Info | [529986] | |||
1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine | Drug Info | [551346] | |||
1H-Indole-2,3-dione | Drug Info | [527719] | |||
2,3,4,5-Tetrahydro-1H-pyrido[4,3-b]indole | Drug Info | [526993] | |||
2-(2,4-dichlorophenyl)-4,5-dihydro-1H-imidazole | Drug Info | [529853] | |||
2-(2-cycloheptylidenehydrazinyl)-4-phenylthiazole | Drug Info | [551222] | |||
2-(2-cyclohexylidenehydrazinyl)-4-p-tolylthiazole | Drug Info | [551222] | |||
2-(2-cyclohexylidenehydrazinyl)-4-phenylthiazole | Drug Info | [551222] | |||
2-(2-cyclopentylidenehydrazinyl)-4-phenylthiazole | Drug Info | [551222] | |||
2-(3-nitrophenyl)-4,5-dihydro-1H-imidazole | Drug Info | [529853] | |||
2-(4,5-dihydro-1H-imidazol-2-yl)quinoline | Drug Info | [529853] | |||
2-(4-chlorophenyl)-4,5-dihydro-1H-imidazole | Drug Info | [529853] | |||
2-(4-fluorophenyl)-7-methoxy-4H-chromen-4-one | Drug Info | [530614] | |||
2-(4-methoxyphenyl)-4H-chromene-4-thione | Drug Info | [530614] | |||
2-(5-phenyl-furan-2-yl)-4,5-dihydro-1H-imidazole | Drug Info | [528409] | |||
2-(naphthalen-2-yl)-4,5-dihydro-1H-imidazole | Drug Info | [529853] | |||
2-BFi | Drug Info | [529853] | |||
2-Bromo-N-(2-morpholinoethyl)nicotinamide | Drug Info | [530675] | |||
2-Bromo-N-(3-morpholinopropyl)nicotinamide | Drug Info | [530675] | |||
2-Chloro-N-(2-morpholinoethyl)nicotinamide | Drug Info | [530675] | |||
2-Chloro-N-(3-morpholinopropyl)nicotinamide | Drug Info | [530675] | |||
2-Furan-2-yl-4,5-dihydro-1H-imidazole | Drug Info | [526918] | |||
2-Hydrazino-3-methyl-4(3H)-quinazolinone | Drug Info | [529873] | |||
2-methyl-9H-indeno[2,1-d]pyrimidin-9-one | Drug Info | [529077] | |||
2-oxo-N-m-tolyl-2H-chromene-3-carboxamide | Drug Info | [530001] | |||
2-oxo-N-p-tolyl-2H-chromene-3-carboxamide | Drug Info | [530001] | |||
2-oxo-N-phenyl-2H-chromene-3-carboxamide | Drug Info | [530001] | |||
2-p-tolyl-4,5-dihydro-1H-imidazole | Drug Info | [529853] | |||
2-p-tolyl-4H-chromen-4-one | Drug Info | [530614] | |||
2-p-tolyl-4H-chromene-4-thione | Drug Info | [530614] | |||
2-Phenethyl-4,5-dihydro-1H-imidazole | Drug Info | [526918] | |||
2-Phenoxymethyl-4,5-dihydro-1H-imidazole | Drug Info | [526918] | |||
2-phenyl-9H-indeno[2,1-d]pyrimidine | Drug Info | [529077] | |||
2-Phenyl-cyclopropylamine hydrochloride | Drug Info | [527283] | |||
2-[7-(Benzyloxy)-2-oxo-2H-chromen-4-yl]acetamide | Drug Info | [530434] | |||
3,4-Benzo-7-(beta-bromoallyloxy)-8-methylcoumarin | Drug Info | [529735] | |||
3,4-Benzo-7-acetonyloxy-8-methoxycoumarin | Drug Info | [529735] | |||
3,4-Dichloro-N-(2-methyl-1H-indol-5-yl)benzamide | Drug Info | [531067] | |||
3-(2-Bromophenyl)-6-methylcoumarin | Drug Info | [531055] | |||
3-(3-methoxyphenyl)-6-methyl-2H-chromen-2-one | Drug Info | [530273] | |||
3-(4-hydroxyphenyl)-6-methyl-2H-chromen-2-one | Drug Info | [530273] | |||
3-(4-methoxyphenyl)-6-methyl-2H-chromen-2-one | Drug Info | [530273] | |||
3-(phenoxymethyl)-5H-indeno[1,2-c]pyridazin-5-one | Drug Info | [529077] | |||
3-Chloro-N-(2-methyl-1H-indol-5-yl)benzamide | Drug Info | [531067] | |||
3-phenyl-9H-indeno[1,2-e][1,2,4]triazin-9-one | Drug Info | [529077] | |||
4,8-Dimethyl-7-(2'-oxocyclohexyloxy)coumarin | Drug Info | [529735] | |||
4,9-Dihydro-3H-beta-carboline | Drug Info | [526994] | |||
4-(2-oxo-2H-chromene-3-carboxamido)benzoic acid | Drug Info | [530001] | |||
4-(Aminomethyl)-7-(benzyloxy)-2H-chromen-2-one | Drug Info | [530434] | |||
4-HYDROXY-N-PROPARGYL-1(R)-AMINOINDAN | Drug Info | [551374] | |||
4-methyl-7-(2-oxocyclopentyloxy)-2H-chromen-2-one | Drug Info | [529735] | |||
4-oxo-4H-chromene-3-carboxylic acid | Drug Info | [530841] | |||
4-phenyl-1,2,3,6-tetrahydropyridine | Drug Info | [551346] | |||
5-Aminomethyl-3-pyrrol-1-yl-oxazolidin-2-one | Drug Info | [526287] | |||
5-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526993] | |||
5-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [526993] | |||
5-Hydroxy-N-Propargyl-1(R)-Aminoindan | Drug Info | [551374] | |||
5-Hydroxymethyl-3-pyrrol-1-yl-oxazolidin-2-one | Drug Info | [526287] | |||
5-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526993] | |||
5-Methoxy-4,9-dihydro-3H-beta-carboline | Drug Info | [526993] | |||
6-amino-9-methoxy-7H-furo[3,2-g]chromen-7-one | Drug Info | [529735] | |||
6-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526993] | |||
6-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [526993] | |||
6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526994] | |||
6-Methoxy-4,9-dihydro-3H-beta-carboline | Drug Info | [526994] | |||
7-(3-chlorobenzyloxy)-4-carboxaldehyde-coumarin | Drug Info | [529080] | |||
7-Acetonyloxy-3,4-cyclohexene-8-methylcoumarin | Drug Info | [529735] | |||
7-Acetonyloxy-3,4-cyclopentene-8-methylcoumarin | Drug Info | [529735] | |||
7-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526993] | |||
7-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [526993] | |||
7-fluoro-2-(4-fluorophenyl)-4H-chromene-4-thione | Drug Info | [530614] | |||
7-fluoro-2-(4-methoxyphenyl)-4H-chromen-4-one | Drug Info | [530614] | |||
7-fluoro-2-p-tolyl-4H-chromen-4-one | Drug Info | [530614] | |||
7-fluoro-2-p-tolyl-4H-chromene-4-thione | Drug Info | [530614] | |||
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526918] | |||
7-methoxy-2-p-tolyl-4H-chromen-4-one | Drug Info | [530614] | |||
7-methoxy-2-p-tolyl-4H-chromene-4-thione | Drug Info | [530614] | |||
7-Methoxy-9H-beta-carboline | Drug Info | [526993] | |||
7-methyl-2-p-tolyl-4H-chromene-4-thione | Drug Info | [530614] | |||
8-(3-Bromobenzyloxy)caffeine | Drug Info | [530647] | |||
8-(3-Chlorobenzyloxy)caffeine | Drug Info | [530647] | |||
8-(3-Fluorobenzyloxy)caffeine | Drug Info | [530647] | |||
8-(3-Methoxybenzyloxy)caffeine | Drug Info | [530647] | |||
8-(3-Methylbenzyloxy)caffeine | Drug Info | [530647] | |||
8-Benzyloxycaffeine | Drug Info | [530647] | |||
8-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526993] | |||
8-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [526993] | |||
8-Bromo-6-methyl-3-(4'-methoxyphenyl)coumarin | Drug Info | [531055] | |||
8-Bromo-6-methyl-3-phenylcoumarin | Drug Info | [531055] | |||
8-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526993] | |||
8-Methoxy-4,9-dihydro-3H-beta-carboline | Drug Info | [526993] | |||
8-[(3-Trifluoromethyl)benzyloxy]caffeine | Drug Info | [530647] | |||
9-Methyl-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [526993] | |||
AS-605240 | Drug Info | [531046] | |||
Benzyl-methyl-[1-(1H-pyrrol-2-yl)-vinyl]-amine | Drug Info | [526566] | |||
Butyl-methyl-prop-2-ynyl-amine hydrochloride | Drug Info | [526820] | |||
C-(1H-Indol-3-yl)-methylamine | Drug Info | [526993] | |||
CGS-19281A | Drug Info | [526994] | |||
CHALCONE | Drug Info | [530087] | |||
CHF-3381 | Drug Info | [536374] | |||
Cis-2-(4-chlorophenyl)-2-fluorocyclopropanamine | Drug Info | [529607] | |||
Cis-2-(para-fluorophenyl)cyclopropylamine | Drug Info | [529607] | |||
Cis-2-Fluoro-2-(4-methoxyphenyl)cyclopropylamine | Drug Info | [529607] | |||
Cis-2-fluoro-2-phenylcyclopropanamine | Drug Info | [529607] | |||
Cis-2-phenylcyclopropylamine | Drug Info | [529607] | |||
CORDOIN | Drug Info | [530087] | |||
Deprenyl | Drug Info | [535505] | |||
EVT-301 | Drug Info | [529908] | |||
Farnesol | Drug Info | [551374] | |||
Flavin-Adenine Dinucleotide | Drug Info | [551393] | |||
Heptyl-methyl-prop-2-ynyl-amine hydrochloride | Drug Info | [526820] | |||
HT-1067 | Drug Info | [549232] | |||
HYDRAZINECARBOXAMIDE | Drug Info | [527283] | |||
IPRONIAZIDE | Drug Info | [530675] | |||
Isatin | Drug Info | [551391] | |||
Isopropyl-methyl-prop-2-ynyl-amine hydrochloride | Drug Info | [526820] | |||
Isopsoralen | Drug Info | [535106] | |||
JD-0100 | Drug Info | [543639] | |||
L-136662 | Drug Info | [531046] | |||
Ladostigil | Drug Info | [531772] | |||
Lauryl Dimethylamine-N-Oxide | Drug Info | [551393] | |||
Lazabemide | Drug Info | [534569] | |||
LAZEBEMIDE | Drug Info | [527719] | |||
Methyl piperate | Drug Info | [530562] | |||
Methyl-(1,2,3,4-tetrahydro-naphthalen-1-yl)-amine | Drug Info | [533451] | |||
Methyl-pentyl-prop-2-ynyl-amine oxalic acid | Drug Info | [526820] | |||
N-(1H-Indol-2-ylmethyl)-N-methyl-N-phenylamine | Drug Info | [529768] | |||
N-(1H-Indol-2-ylmethyl)-N-phenylamine | Drug Info | [529768] | |||
N-(2-aminoethyl)-2-oxo-2H-chromene-3-carboxamide | Drug Info | [530001] | |||
N-(2-AMINOETHYL)-P-CHLOROBENZAMIDE | Drug Info | [551374] | |||
N-(2-Methyl-1H-indol-5-yl)benzamide | Drug Info | [531067] | |||
N-(2-Methyl-1H-indol-5-yl)cyclohexanecarboxamide | Drug Info | [531067] | |||
N-(2-phenylethyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [528641] | |||
N-(2-Phenylethyl)-1H-indole-2-carboxamide | Drug Info | [529768] | |||
N-(3-Phenylpropyl)-1H-indole-2-carboxamide | Drug Info | [529768] | |||
N-(4-Ethylphenyl)-2-oxo-2H-chromene-3-carboxamide | Drug Info | [530001] | |||
N-(4-Phenylbutyl)-1H-indole-2-carboxamide | Drug Info | [529768] | |||
N-(benzyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [528641] | |||
N-(propargyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [528641] | |||
N-Benzyl,N-methyl-1H-indole-2-carboxamide | Drug Info | [529768] | |||
N-Benzyl-1H-indole-2-carboxamide | Drug Info | [529768] | |||
N-benzyl-2-oxo-2H-chromene-3-carboxamide | Drug Info | [530001] | |||
N-Benzyl-N-(1H-indol-2-ylmethyl)-N-methylamine | Drug Info | [529768] | |||
N-cyclohexyl-2-oxo-2H-chromene-3-carboxamide | Drug Info | [530001] | |||
N-isobutyl-2-oxo-2H-chromene-3-carboxamide | Drug Info | [530001] | |||
N-methyl,N-(benzyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [528641] | |||
N-methyl,N-(propargyl),N-(pyrrol-2-ylmethyl)amine | Drug Info | [528641] | |||
N-Methyl,N-phenyl-1H-indole-2-carboxamide | Drug Info | [529768] | |||
N-Methyl-N-phenyl-2-oxo-2H-chromene-3-carboxamide | Drug Info | [530001] | |||
N-Methyl-N-Propargyl-1(R)-Aminoindan | Drug Info | [551374] | |||
N-Phenyl-1H-indole-2-carboxamide | Drug Info | [529768] | |||
N-Propargyl-1(S)-Aminoindan | Drug Info | [551374] | |||
N2-[4-(benzyloxy)benzyl]glycinamide | Drug Info | [529025] | |||
N2-{4-[(3-chlorobenzyl)oxy]benzyl}glycinamide | Drug Info | [529025] | |||
N2-{4-[(3-fluorobenzyl)oxy]benzyl}glycinamide | Drug Info | [529025] | |||
N2-{4-[(4-chlorobenzyl)oxy]benzyl}glycinamide | Drug Info | [529025] | |||
N2-{4-[(4-nitrobenzyl)oxy]benzyl}glycinamide | Drug Info | [529025] | |||
NSC-50187 | Drug Info | [530614] | |||
NSC-50393 | Drug Info | [530614] | |||
NSC-93405 | Drug Info | [530614] | |||
NW-1772 | Drug Info | [543639] | |||
P2B-001 | Drug Info | [528670] | |||
Pargyline | Drug Info | [537499] | |||
PF9601N | Drug Info | [536923] | |||
Phenelzine | Drug Info | [536743] | |||
Phenyl 4-(4,5-dihydro-1H-imidazol-2-yl)benzoate | Drug Info | [529853] | |||
PIPERINE | Drug Info | [530562] | |||
PNU-22394 | Drug Info | [526993] | |||
Psoralen | Drug Info | [535106] | |||
Rasagiline | Drug Info | [537470] | |||
RS-1636 | Drug Info | [535422] | |||
RS-1653 | Drug Info | [535422] | |||
RWJ-416457 | Drug Info | [543639] | |||
Safinamide | Drug Info | [536266], [536498] | |||
Selegiline | Drug Info | [543639] | |||
SKL-PD | Drug Info | [543639] | |||
SL-25.1188 | Drug Info | [530356] | |||
TOLOXATONE | Drug Info | [526287] | |||
TRACIZOLINE | Drug Info | [526918] | |||
Trans-2-(4-chlorophenyl)-2-fluorocyclopropanamine | Drug Info | [529607] | |||
Trans-2-fluoro-2-(4-fluorophenyl)cyclopropanamine | Drug Info | [529607] | |||
Trans-2-fluoro-2-p-tolylcyclopropanamine | Drug Info | [529607] | |||
Trans-2-fluoro-2-phenylcyclopropylamin | Drug Info | [529607] | |||
Tranylcypromine | Drug Info | [536265], [537851] | |||
TRYPTAMINE | Drug Info | [526993] | |||
TRYPTOLINE | Drug Info | [526918] | |||
VAR-10300 | Drug Info | [543639] | |||
Zydis selegiline | Drug Info | [536266] | |||
[(1e)-4-Phenylbut-1-Enyl]Benzene | Drug Info | [551374] | |||
Modulator | 4-fluoroselegiline | Drug Info | [533786] | ||
Indeloxazine | Drug Info | [551871] | |||
LU-53439 | Drug Info | ||||
Milacemide | Drug Info | [530942] | |||
MOFEGILINE | Drug Info | [529842] | |||
Neu-120 | Drug Info | ||||
RG1577 | Drug Info | [550238] | |||
Selegiline Hydrochloride | Drug Info | [556264] | |||
VAR-10200 | Drug Info | [543639] | |||
Antagonist | 4-Methoxyamphetamine | Drug Info | [551380] | ||
MMDA | Drug Info | [551393] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Superpathway of tryptophan utilization | ||||
Tryptophan degradation via tryptamine | |||||
Dopamine degradation | |||||
Putrescine degradation III | |||||
Noradrenaline and adrenaline degradation | |||||
KEGG Pathway | Glycine, serine and threonine metabolism | ||||
Arginine and proline metabolism | |||||
Histidine metabolism | |||||
Tyrosine metabolism | |||||
Phenylalanine metabolism | |||||
Tryptophan metabolism | |||||
Drug metabolism - cytochrome P450 | |||||
Metabolic pathways | |||||
Serotonergic synapse | |||||
Dopaminergic synapse | |||||
Cocaine addiction | |||||
Amphetamine addiction | |||||
Alcoholism | |||||
PANTHER Pathway | Adrenaline and noradrenaline biosynthesis | ||||
5-Hydroxytryptamine degredation | |||||
Dopamine receptor mediated signaling pathway | |||||
Pathway Interaction Database | Alpha-synuclein signaling | ||||
WikiPathways | Tryptophan metabolism | ||||
Dopamine metabolism | |||||
Phase 1 - Functionalization of compounds | |||||
References | |||||
Ref 521730 | ClinicalTrials.gov (NCT00227136) Effect of Oral 5-HTP Intake on Urinary 5-HIAA Excretion. U.S. National Institutes of Health. | ||||
Ref 522217 | ClinicalTrials.gov (NCT00607451) Safety, Tolerability, PK and PD Study of Neu-120 in the Treatment of Levodopa-induced Dyskinesia. U.S. National Institutes of Health. | ||||
Ref 522265 | ClinicalTrials.gov (NCT00640159) Tolerability and Efficacy of Switch From Oral Selegiline to Orally Disintegrating Selegiline (Zelapar) in Patients With Parkinson's Disease. U.S. National Institutes of Health. | ||||
Ref 523529 | ClinicalTrials.gov (NCT01383694) Effect Of Piperine In Patients With Oropharyngeal Dysphagia. U.S. National Institutes of Health. | ||||
Ref 524054 | ClinicalTrials.gov (NCT01686594) PUVA Maintenance Therapy in Mycosis Fungoides. U.S. National Institutes of Health. | ||||
Ref 524487 | ClinicalTrials.gov (NCT01968460) Safety, Tolerability and Efficacy of Two Doses of Once Daily P2B001 in Subjects With Early Parkinson's Disease. U.S. National Institutes of Health. | ||||
Ref 529017 | Indantadol, a novel NMDA antagonist and nonselective MAO inhibitor for the potential treatment of neuropathic pain. IDrugs. 2007 Sep;10(9):636-44. | ||||
Ref 529304 | CYP-dependent metabolism of PF9601N, a new monoamine oxidase-B inhibitor, by C57BL/6 mouse and human liver microsomes. J Pharm Pharm Sci. 2007;10(4):473-85. | ||||
Ref 530942 | Milacemide, the selective substrate and enzyme-activated specific inhibitor of monoamine oxidase B, increases dopamine but not serotonin in caudate nucleus of rhesus monkey. Neurochem Int. 1990;17(2):325-9. | ||||
Ref 531772 | Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94. | ||||
Ref 536285 | Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54. | ||||
Ref 536923 | Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. | ||||
Ref 538452 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011909. | ||||
Ref 538764 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 125). | ||||
Ref 539613 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2489). | ||||
Ref 541748 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6639). | ||||
Ref 541750 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6640). | ||||
Ref 541751 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6641). | ||||
Ref 542285 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7266). | ||||
Ref 543044 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8291). | ||||
Ref 545271 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002656) | ||||
Ref 545650 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004032) | ||||
Ref 547083 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012921) | ||||
Ref 547487 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016773) | ||||
Ref 548293 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024230) | ||||
Ref 548499 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026046) | ||||
Ref 549231 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034020) | ||||
Ref 526287 | J Med Chem. 2002 Mar 14;45(6):1180-3.3-(1H-Pyrrol-1-yl)-2-oxazolidinones as reversible, highly potent, and selective inhibitors of monoamine oxidase type A. | ||||
Ref 526566 | J Med Chem. 2003 Mar 13;46(6):917-20.Simple, potent, and selective pyrrole inhibitors of monoamine oxidase types A and B. | ||||
Ref 526820 | J Med Chem. 1992 Oct 2;35(20):3705-13.Aliphatic propargylamines: potent, selective, irreversible monoamine oxidase B inhibitors. | ||||
Ref 526918 | Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9.Binding of an imidazopyridoindole at imidazoline I2 receptors. | ||||
Ref 526993 | Bioorg Med Chem Lett. 2004 Feb 23;14(4):999-1002.Binding of beta-carbolines at imidazoline I2 receptors: a structure-affinity investigation. | ||||
Ref 526994 | Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5.Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands. | ||||
Ref 527283 | J Med Chem. 2004 Nov 18;47(24):5860-71.Fluorinated phenylcyclopropylamines. 2. Effects of aromatic ring substitution and of absolute configuration on inhibition of microbial tyramine oxidase. | ||||
Ref 527719 | Bioorg Med Chem Lett. 2005 Oct 15;15(20):4438-46.Docking studies on monoamine oxidase-B inhibitors: estimation of inhibition constants (K(i)) of a series of experimentally tested compounds. | ||||
Ref 528409 | J Med Chem. 2006 Sep 7;49(18):5578-86.3-[5-(4,5-dihydro-1H-imidazol-2-yl)-furan-2-yl]phenylamine (Amifuraline), a promising reversible and selective peripheral MAO-A inhibitor. | ||||
Ref 528641 | J Med Chem. 2007 Mar 8;50(5):922-31. Epub 2007 Jan 26.New pyrrole inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity. | ||||
Ref 528670 | Rasagiline (TVP-1012): a new selective monoamine oxidase inhibitor for Parkinson's disease. Am J Geriatr Pharmacother. 2006 Dec;4(4):330-46. | ||||
Ref 528855 | Bioorg Med Chem. 2007 Aug 1;15(15):5198-206. Epub 2007 May 22.Human and rat monoamine oxidase-A are differentially inhibited by (S)-4-alkylthioamphetamine derivatives: insights from molecular modeling studies. | ||||
Ref 529025 | J Med Chem. 2007 Oct 4;50(20):4909-16. Epub 2007 Sep 7.Solid-phase synthesis and insights into structure-activity relationships of safinamide analogues as potent and selective inhibitors of type B monoamine oxidase. | ||||
Ref 529077 | J Med Chem. 2007 Nov 1;50(22):5364-71. Epub 2007 Oct 2.Synthesis and monoamine oxidase inhibitory activity of new pyridazine-, pyrimidine- and 1,2,4-triazine-containing tricyclic derivatives. | ||||
Ref 529080 | J Med Chem. 2007 Nov 15;50(23):5848-52. Epub 2007 Oct 4.Structures of human monoamine oxidase B complexes with selective noncovalent inhibitors: safinamide and coumarin analogs. | ||||
Ref 529607 | Bioorg Med Chem. 2008 Aug 1;16(15):7148-66. Epub 2008 Jun 28.Fluorinated phenylcyclopropylamines. Part 5: Effects of electron-withdrawing or -donating aryl substituents on the inhibition of monoamine oxidases A and B by 2-aryl-2-fluoro-cyclopropylamines. | ||||
Ref 529735 | J Med Chem. 2008 Nov 13;51(21):6740-51. Epub 2008 Oct 4.Quantitative structure-activity relationship and complex network approach to monoamine oxidase A and B inhibitors. | ||||
Ref 529768 | Bioorg Med Chem. 2008 Nov 15;16(22):9729-40. Epub 2008 Oct 2.Synthesis, structure-activity relationships and molecular modeling studies of new indole inhibitors of monoamine oxidases A and B. | ||||
Ref 529842 | J Med Chem. 2008 Dec 25;51(24):8019-26.Structural and mechanistic studies of mofegiline inhibition of recombinant human monoamine oxidase B. | ||||
Ref 529853 | Bioorg Med Chem Lett. 2009 Jan 15;19(2):546-9. Epub 2008 Mar 6.Ultrasound promoted synthesis of 2-imidazolines in water: a greener approach toward monoamine oxidase inhibitors. | ||||
Ref 529873 | Bioorg Med Chem. 2009 Jan 15;17(2):675-89. Epub 2008 Dec 3.New pyrazoline bearing 4(3H)-quinazolinone inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity. | ||||
Ref 529908 | Assessment of MAO-B occupancy in the brain with PET and [11C]-L-deprenyl-D2: a dose-finding study with a novel MAO-B inhibitor, EVT 301. Clin Pharmacol Ther. 2009 May;85(5):506-12. | ||||
Ref 529986 | Bioorg Med Chem. 2009 Mar 15;17(6):2452-60. Epub 2009 Feb 8.Naphthylisopropylamine and N-benzylamphetamine derivatives as monoamine oxidase inhibitors. | ||||
Ref 530001 | J Med Chem. 2009 Apr 9;52(7):1935-42.Synthesis, molecular modeling, and selective inhibitory activity against human monoamine oxidases of 3-carboxamido-7-substituted coumarins. | ||||
Ref 530056 | Bioorg Med Chem Lett. 2009 May 1;19(9):2509-13. Epub 2009 Mar 14.Inhibition of monoamine oxidase by (E)-styrylisatin analogues. | ||||
Ref 530087 | J Med Chem. 2009 May 14;52(9):2818-24.Chalcones: a valid scaffold for monoamine oxidases inhibitors. | ||||
Ref 530273 | Bioorg Med Chem Lett. 2009 Sep 1;19(17):5053-5. Epub 2009 Jul 10.Synthesis and evaluation of 6-methyl-3-phenylcoumarins as potent and selective MAO-B inhibitors. | ||||
Ref 530356 | [(11)C]SL25.1188, a new reversible radioligand to study the monoamine oxidase type B with PET: preclinical characterisation in nonhuman primate. Synapse. 2010 Jan;64(1):61-9. | ||||
Ref 530425 | Bioorg Med Chem. 2009 Nov 1;17(21):7523-30. Epub 2009 Sep 15.Synthesis and in vitro evaluation of pteridine analogues as monoamine oxidase B and nitric oxide synthase inhibitors. | ||||
Ref 530434 | J Med Chem. 2009 Nov 12;52(21):6685-706.Discovery of a novel class of potent coumarin monoamine oxidase B inhibitors: development and biopharmacological profiling of 7-[(3-chlorobenzyl)oxy]-4-[(methylamino)methyl]-2H-chromen-2-one methanesulfonate (NW-1772) as a highly potent, selective, reversible, and orally active monoamine oxidase B inhibitor. | ||||
Ref 530562 | Bioorg Med Chem Lett. 2010 Jan 15;20(2):537-40. Epub 2009 Nov 26.Proposed structural basis of interaction of piperine and related compounds with monoamine oxidases. | ||||
Ref 530614 | Bioorg Med Chem. 2010 Feb;18(3):1273-9. Epub 2010 Jan 4.A new series of flavones, thioflavones, and flavanones as selective monoamine oxidase-B inhibitors. | ||||
Ref 530647 | Bioorg Med Chem. 2010 Feb;18(3):1018-28. Epub 2010 Jan 6.Inhibition of monoamine oxidase by 8-benzyloxycaffeine analogues. | ||||
Ref 530675 | Bioorg Med Chem. 2010 Feb 15;18(4):1659-64. Epub 2010 Jan 4.Design of novel nicotinamides as potent and selective monoamine oxidase a inhibitors. | ||||
Ref 530683 | Bioorg Med Chem. 2010 Feb 15;18(4):1388-95. Epub 2010 Jan 15.2-Arylthiomorpholine derivatives as potent and selective monoamine oxidase B inhibitors. | ||||
Ref 530841 | Bioorg Med Chem Lett. 2010 May 1;20(9):2709-12. Epub 2010 Mar 27.Chromone-2- and -3-carboxylic acids inhibit differently monoamine oxidases A and B. | ||||
Ref 530942 | Milacemide, the selective substrate and enzyme-activated specific inhibitor of monoamine oxidase B, increases dopamine but not serotonin in caudate nucleus of rhesus monkey. Neurochem Int. 1990;17(2):325-9. | ||||
Ref 531046 | Bioorg Med Chem Lett. 2010 Sep 1;20(17):5295-8. Epub 2010 Jul 1.Identification of novel monoamine oxidase B inhibitors by structure-based virtual screening. | ||||
Ref 531055 | Bioorg Med Chem Lett. 2010 Sep 1;20(17):5157-60. Epub 2010 Jul 8.New halogenated 3-phenylcoumarins as potent and selective MAO-B inhibitors. | ||||
Ref 531067 | Eur J Med Chem. 2010 Oct;45(10):4458-66. Epub 2010 Jul 31.Inhibition of monoamine oxidase by indole and benzofuran derivatives. | ||||
Ref 531772 | Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94. | ||||
Ref 533451 | J Med Chem. 1988 Aug;31(8):1558-66.Stereoisomers of allenic amines as inactivators of monoamine oxidase type B. Stereochemical probes of the active site. | ||||
Ref 533786 | Multiple, small dose administration of (-)deprenyl enhances catecholaminergic activity and diminishes serotoninergic activity in the brain and these effects are unrelated to MAO-B inhibition. Arch Int Pharmacodyn Ther. 1994 Jul-Aug;328(1):1-15. | ||||
Ref 535106 | Inhibition of rat brain monoamine oxidase activities by psoralen and isopsoralen: implications for the treatment of affective disorders. Pharmacol Toxicol. 2001 Feb;88(2):75-80. | ||||
Ref 535422 | Novel monoamine oxidase inhibitors, 3-(2-aminoethoxy)-1,2-benzisoxazole derivatives, and their differential reversibility. Jpn J Pharmacol. 2002 Feb;88(2):174-82. | ||||
Ref 535505 | The effect of deprenyl washout in patients with long-standing Parkinson's disease. J Neural Transm. 2002 May;109(5-6):797-803. | ||||
Ref 536265 | Tranylcypromine: new perspectives on an "old" drug. Eur Arch Psychiatry Clin Neurosci. 2006 Aug;256(5):268-73. | ||||
Ref 536743 | Limitation of adipose tissue enlargement in rats chronically treated with semicarbazide-sensitive amine oxidase and monoamine oxidase inhibitors. Pharmacol Res. 2008 Jun;57(6):426-34. Epub 2008 Apr 24. | ||||
Ref 536923 | Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42. | ||||
Ref 537470 | Glyceraldehyde-3-Phosphate Dehydrogenase-Monoamine Oxidase B-Mediated Cell Death-Induced by Ethanol is Prevented by Rasagiline and 1-R-Aminoindan. Neurotox Res. 2009 Aug;16(2):148-59. Epub 2009 May 28. | ||||
Ref 537499 | Dose-dependent activation of distinct hypertrophic pathways by serotonin in cardiac cells. Am J Physiol Heart Circ Physiol. 2009 Aug;297(2):H821-8. Epub 2009 Jun 19. | ||||
Ref 537851 | Dopamine D2 receptors: a potential pharmacological target for nomifensine and tranylcypromine but not other antidepressant treatments. Pharmacol Biochem Behav. 1995 Aug;51(4):565-9. | ||||
Ref 543639 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2490). | ||||
Ref 549232 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034020) | ||||
Ref 551222 | Synthesis, semipreparative HPLC separation, biological evaluation, and 3D-QSAR of hydrazothiazole derivatives as human monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Jul 15;18(14):5063-70. doi: 10.1016/j.bmc.2010.05.070. Epub 2010 Jun 1. | ||||
Ref 551380 | Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77. | ||||
Ref 551391 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.