Target General Infomation
Target ID
T83011
Former ID
TTDS00341
Target Name
Amine oxidase [flavin-containing] B
Gene Name
MAOB
Synonyms
MAO-B; Monoamine oxidase; Monoamine oxidase B; MAOB
Target Type
Successful
Disease Alzheimer disease [ICD9: 331; ICD10: G30]
Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99]
Central nervous system disease [ICD10: G00-G99]
Cognitive disorders [ICD9: 290-294, 294.0, 780.09, 780.9, 780.93; ICD10: F01-F07, F04, F05, R41.3]
Depression; Anxiety disorder [ICD9:311, 300; ICD10: F30-F39, F32, F40-F42]
Dementia [ICD9: 290-294; ICD10: F01-F07]
Idiopathic parkinson's disease [ICD9: 332; ICD10: F02.3, G20]
Major depressive disorder [ICD9: 296.2, 296.3, 710.0; ICD10: F32, F33, M32]
Moderate to severe hypertension [ICD10: I10-I16]
Motor symptoms; Parkinson's disease [ICD9: 332, 335.2; ICD10: F02.3, G12.2, G20]
Major depressive episode without melancholia [ICD10: F30-F39]
Neurodegenerative disease [ICD9: 330-337; ICD10: G30-G32]
Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0]
Obesity [ICD9: 278; ICD10: E66]
Parkinson's disease [ICD9: 332; ICD10: G20]
Vitiligo [ICD9: 709.01; ICD10: L80]
Unspecified [ICD code not available]
Function
Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine.
BioChemical Class
Oxidoreductases acting on CH-NH2 group of donors
Target Validation
T83011
UniProt ID
EC Number
EC 1.4.3.4
Sequence
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Drugs and Mode of Action
Drug(s) Indeloxazine Drug Info Approved Dementia [551871]
Pargyline Drug Info Approved Moderate to severe hypertension [551871]
Phenelzine Drug Info Approved Depression; Anxiety disorder [538452], [542285], [551871]
Rasagiline Drug Info Approved Parkinson's disease [536285], [541751]
Safinamide Drug Info Approved Parkinson's disease [889446]
Selegiline Drug Info Approved Major depressive disorder [522265], [541748]
Selegiline Hydrochloride Drug Info Approved Parkinson's disease [551871]
Tranylcypromine Drug Info Approved Major depressive episode without melancholia [551871]
Psoralen Drug Info Phase 3 Discovery agent [524054]
Safinamide Drug Info Phase 3 Idiopathic parkinson's disease [536923], [543044]
TRYPTAMINE Drug Info Phase 3 Discovery agent [521730], [538764]
P2B-001 Drug Info Phase 2/3 Parkinson's disease [524487]
CHF-3381 Drug Info Phase 2 Neuropathic pain [529017], [536374]
Ladostigil Drug Info Phase 2 Alzheimer disease [531772]
RG1577 Drug Info Phase 2 Alzheimer disease [548499]
Neu-120 Drug Info Phase 1/2 Parkinson's disease [522217]
PIPERINE Drug Info Phase 1/2 Vitiligo [523529], [539613]
PF9601N Drug Info Phase 1 Parkinson's disease [529304]
RWJ-416457 Drug Info Preclinical Bacterial infections [547487]
Lazabemide Drug Info Discontinued in Phase 3 Cognitive disorders [541750], [545650]
MOFEGILINE Drug Info Discontinued in Phase 3 Cognitive disorders [545271]
EVT-301 Drug Info Discontinued in Phase 1 Alzheimer disease [548293]
HT-1067 Drug Info Discontinued in Phase 1 Parkinson's disease [549231]
SL-25.1188 Drug Info Discontinued in Phase 1 Alzheimer disease [547083]
Milacemide Drug Info Terminated Alzheimer disease [530942]
Inhibitor (+/-)-2-(4'-Benzyloxyphenyl)thiomorpholin-5-one Drug Info [530683]
(+/-)-2-(4'-Benzyloxyphenyl)thiomorpholine Drug Info [530683]
(+/-)-2-(4'-Butoxyphenyl)thiomorpholin-5-one Drug Info [530683]
(+/-)-2-(4'-Butoxyphenyl)thiomorpholine Drug Info [530683]
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholin-5-one Drug Info [530683]
(+/-)-2-(4'-Ethoxyphenyl)thiomorpholine Drug Info [530683]
(+/-)-2-(4'-Methoxyphenyl)thiomorpholin-5-one Drug Info [530683]
(+/-)-2-(4'-Methoxyphenyl)thiomorpholine Drug Info [530683]
(+/-)-2-(4'-Propoxyphenyl)thiomorpholin-5-one Drug Info [530683]
(+/-)-2-(4'-Propoxyphenyl)thiomorpholine Drug Info [530683]
(+/-)-2-(4-fluorophenyl)-7-methoxychroman-4-one Drug Info [530614]
(+/-)-2-(4-fluorophenyl)-7-methylchroman-4-one Drug Info [530614]
(+/-)-2-(4-fluorophenyl)chroman-4-one Drug Info [530614]
(+/-)-2-(4-methoxyphenyl)-7-methylchroman-4-one Drug Info [530614]
(+/-)-2-p-tolylchroman-4-one Drug Info [530614]
(+/-)-2-Phenylthiomorpholin-5-one Drug Info [530683]
(+/-)-2-Phenylthiomorpholine Drug Info [530683]
(+/-)-7-fluoro-2-(4-fluorophenyl)chroman-4-one Drug Info [530614]
(+/-)-7-fluoro-2-(4-methoxyphenyl)chroman-4-one Drug Info [530614]
(+/-)-7-fluoro-2-p-tolylchroman-4-one Drug Info [530614]
(+/-)-7-fluoro-2-phenylchroman-4-one Drug Info [530614]
(+/-)-7-methoxy-2-(4-methoxyphenyl)chroman-4-one Drug Info [530614]
(+/-)-7-methoxy-2-p-tolylchroman-4-one Drug Info [530614]
(+/-)-7-methoxy-2-phenylchroman-4-one Drug Info [530614]
(+/-)-7-methyl-2-p-tolylchroman-4-one Drug Info [530614]
(+/-)-7-methyl-2-phenylchroman-4-one Drug Info [530614]
(6-Benzyloxy-2-naphthyl)-2-aminopropane Drug Info [529986]
(6-Ethoxy-2-naphthyl)-2-aminopropane Drug Info [529986]
(6-Methoxy-2-naphthyl)-2-aminopropane Drug Info [529986]
(6-Propoxy-2-naphthyl)-2-aminopropane Drug Info [529986]
(7-Benzyloxy-2-oxo-2H-chromen-4-yl)acetonitrile Drug Info [530434]
(E)-5-(3-Chlorostyryl)isatin Drug Info [530056]
(E)-5-(3-Fluorostyryl)isatin Drug Info [530056]
(E)-5-Styrylisatin Drug Info [530056]
(E)-6-Styrylisatin Drug Info [530056]
(E)-8-(3-chlorostyryl)-caffeine Drug Info [530425]
(R)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one Drug Info [530614]
(R)(+)-7-fluoro-2-(4-fluorophenyl)chroman-4-one Drug Info [530614]
(R)(+)-7-fluoro-2-p-tolylchroman-4-one Drug Info [530614]
(R)(+)-7-fluoro-2-phenylchroman-4-one Drug Info [530614]
(R)(+)-7-methyl-2-p-tolylchroman-4-one Drug Info [530614]
(R)(+)-7-methyl-2-phenylchroman-4-one Drug Info [530614]
(R)-3-Prop-2-ynylamino-indan-5-ol Drug Info [527719]
(R)-Indan-1-yl-methyl-prop-2-ynyl-amine Drug Info [527719]
(R)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}alaninamide Drug Info [529025]
(R)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}serinamide Drug Info [529025]
(R)-N2-{4-[(3-fluorobenzyl)oxy]benzyl}alaninamide Drug Info [529025]
(R/R)BEFLOXATONE Drug Info [526287]
(S)(+)-2-(4-fluorophenyl)-7-methoxychroman-4-one Drug Info [530614]
(S)(+)-7-fluoro-2-(4-fluorophenyl)chroman-4-one Drug Info [530614]
(S)(+)-7-fluoro-2-p-tolylchroman-4-one Drug Info [530614]
(S)(+)-7-fluoro-2-phenylchroman-4-one Drug Info [530614]
(S)(+)-7-methyl-2-p-tolylchroman-4-one Drug Info [530614]
(S)(+)-7-methyl-2-phenylchroman-4-one Drug Info [530614]
(S)-2-amino-1-(4-butylthiophenyl)-propane Drug Info [528855]
(S)-2-amino-1-(4-propylthiophenyl)-propane Drug Info [528855]
(S)-N2-[4-(benzyloxy)benzyl]alaninamide Drug Info [529025]
(S)-N2-[4-(benzyloxy)benzyl]serinamide Drug Info [529025]
(S)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}alaninamide Drug Info [529025]
(S)-N2-{4-[(3-chlorobenzyl)oxy]benzyl}serinamide Drug Info [529025]
(S)-N2-{4-[(3-fluorobenzyl)oxy]benzyl}serinamide Drug Info [529025]
(S)-N2-{4-[(4-chlorobenzyl)oxy]benzyl}alaninamide Drug Info [529025]
(S)-N2-{4-[(4-chlorobenzyl)oxy]benzyl}serinamide Drug Info [529025]
(S)-N2-{4-[(4-nitrobenzyl)oxy]benzyl}serinamide Drug Info [529025]
1,2,3,4-Tetrahydro-naphthalen-1-ylamine Drug Info [533451]
1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole Drug Info [526994]
1,4-diphenyl-(1E,3E)-1,3-butadiene Drug Info [527719]
1-(4-(benzyloxy)phenyl)propan-2-amine Drug Info [529986]
1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine Drug Info [551346]
1H-Indole-2,3-dione Drug Info [527719]
2,3,4,5-Tetrahydro-1H-pyrido[4,3-b]indole Drug Info [526993]
2-(2,4-dichlorophenyl)-4,5-dihydro-1H-imidazole Drug Info [529853]
2-(2-cycloheptylidenehydrazinyl)-4-phenylthiazole Drug Info [551222]
2-(2-cyclohexylidenehydrazinyl)-4-p-tolylthiazole Drug Info [551222]
2-(2-cyclohexylidenehydrazinyl)-4-phenylthiazole Drug Info [551222]
2-(2-cyclopentylidenehydrazinyl)-4-phenylthiazole Drug Info [551222]
2-(3-nitrophenyl)-4,5-dihydro-1H-imidazole Drug Info [529853]
2-(4,5-dihydro-1H-imidazol-2-yl)quinoline Drug Info [529853]
2-(4-chlorophenyl)-4,5-dihydro-1H-imidazole Drug Info [529853]
2-(4-fluorophenyl)-7-methoxy-4H-chromen-4-one Drug Info [530614]
2-(4-methoxyphenyl)-4H-chromene-4-thione Drug Info [530614]
2-(5-phenyl-furan-2-yl)-4,5-dihydro-1H-imidazole Drug Info [528409]
2-(naphthalen-2-yl)-4,5-dihydro-1H-imidazole Drug Info [529853]
2-BFi Drug Info [529853]
2-Bromo-N-(2-morpholinoethyl)nicotinamide Drug Info [530675]
2-Bromo-N-(3-morpholinopropyl)nicotinamide Drug Info [530675]
2-Chloro-N-(2-morpholinoethyl)nicotinamide Drug Info [530675]
2-Chloro-N-(3-morpholinopropyl)nicotinamide Drug Info [530675]
2-Furan-2-yl-4,5-dihydro-1H-imidazole Drug Info [526918]
2-Hydrazino-3-methyl-4(3H)-quinazolinone Drug Info [529873]
2-methyl-9H-indeno[2,1-d]pyrimidin-9-one Drug Info [529077]
2-oxo-N-m-tolyl-2H-chromene-3-carboxamide Drug Info [530001]
2-oxo-N-p-tolyl-2H-chromene-3-carboxamide Drug Info [530001]
2-oxo-N-phenyl-2H-chromene-3-carboxamide Drug Info [530001]
2-p-tolyl-4,5-dihydro-1H-imidazole Drug Info [529853]
2-p-tolyl-4H-chromen-4-one Drug Info [530614]
2-p-tolyl-4H-chromene-4-thione Drug Info [530614]
2-Phenethyl-4,5-dihydro-1H-imidazole Drug Info [526918]
2-Phenoxymethyl-4,5-dihydro-1H-imidazole Drug Info [526918]
2-phenyl-9H-indeno[2,1-d]pyrimidine Drug Info [529077]
2-Phenyl-cyclopropylamine hydrochloride Drug Info [527283]
2-[7-(Benzyloxy)-2-oxo-2H-chromen-4-yl]acetamide Drug Info [530434]
3,4-Benzo-7-(beta-bromoallyloxy)-8-methylcoumarin Drug Info [529735]
3,4-Benzo-7-acetonyloxy-8-methoxycoumarin Drug Info [529735]
3,4-Dichloro-N-(2-methyl-1H-indol-5-yl)benzamide Drug Info [531067]
3-(2-Bromophenyl)-6-methylcoumarin Drug Info [531055]
3-(3-methoxyphenyl)-6-methyl-2H-chromen-2-one Drug Info [530273]
3-(4-hydroxyphenyl)-6-methyl-2H-chromen-2-one Drug Info [530273]
3-(4-methoxyphenyl)-6-methyl-2H-chromen-2-one Drug Info [530273]
3-(phenoxymethyl)-5H-indeno[1,2-c]pyridazin-5-one Drug Info [529077]
3-Chloro-N-(2-methyl-1H-indol-5-yl)benzamide Drug Info [531067]
3-phenyl-9H-indeno[1,2-e][1,2,4]triazin-9-one Drug Info [529077]
4,8-Dimethyl-7-(2'-oxocyclohexyloxy)coumarin Drug Info [529735]
4,9-Dihydro-3H-beta-carboline Drug Info [526994]
4-(2-oxo-2H-chromene-3-carboxamido)benzoic acid Drug Info [530001]
4-(Aminomethyl)-7-(benzyloxy)-2H-chromen-2-one Drug Info [530434]
4-HYDROXY-N-PROPARGYL-1(R)-AMINOINDAN Drug Info [551374]
4-methyl-7-(2-oxocyclopentyloxy)-2H-chromen-2-one Drug Info [529735]
4-oxo-4H-chromene-3-carboxylic acid Drug Info [530841]
4-phenyl-1,2,3,6-tetrahydropyridine Drug Info [551346]
5-Aminomethyl-3-pyrrol-1-yl-oxazolidin-2-one Drug Info [526287]
5-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
5-Bromo-4,9-dihydro-3H-beta-carboline Drug Info [526993]
5-Hydroxy-N-Propargyl-1(R)-Aminoindan Drug Info [551374]
5-Hydroxymethyl-3-pyrrol-1-yl-oxazolidin-2-one Drug Info [526287]
5-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
5-Methoxy-4,9-dihydro-3H-beta-carboline Drug Info [526993]
6-amino-9-methoxy-7H-furo[3,2-g]chromen-7-one Drug Info [529735]
6-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
6-Bromo-4,9-dihydro-3H-beta-carboline Drug Info [526993]
6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526994]
6-Methoxy-4,9-dihydro-3H-beta-carboline Drug Info [526994]
7-(3-chlorobenzyloxy)-4-carboxaldehyde-coumarin Drug Info [529080]
7-Acetonyloxy-3,4-cyclohexene-8-methylcoumarin Drug Info [529735]
7-Acetonyloxy-3,4-cyclopentene-8-methylcoumarin Drug Info [529735]
7-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
7-Bromo-4,9-dihydro-3H-beta-carboline Drug Info [526993]
7-fluoro-2-(4-fluorophenyl)-4H-chromene-4-thione Drug Info [530614]
7-fluoro-2-(4-methoxyphenyl)-4H-chromen-4-one Drug Info [530614]
7-fluoro-2-p-tolyl-4H-chromen-4-one Drug Info [530614]
7-fluoro-2-p-tolyl-4H-chromene-4-thione Drug Info [530614]
7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526918]
7-methoxy-2-p-tolyl-4H-chromen-4-one Drug Info [530614]
7-methoxy-2-p-tolyl-4H-chromene-4-thione Drug Info [530614]
7-Methoxy-9H-beta-carboline Drug Info [526993]
7-methyl-2-p-tolyl-4H-chromene-4-thione Drug Info [530614]
8-(3-Bromobenzyloxy)caffeine Drug Info [530647]
8-(3-Chlorobenzyloxy)caffeine Drug Info [530647]
8-(3-Fluorobenzyloxy)caffeine Drug Info [530647]
8-(3-Methoxybenzyloxy)caffeine Drug Info [530647]
8-(3-Methylbenzyloxy)caffeine Drug Info [530647]
8-Benzyloxycaffeine Drug Info [530647]
8-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
8-Bromo-4,9-dihydro-3H-beta-carboline Drug Info [526993]
8-Bromo-6-methyl-3-(4'-methoxyphenyl)coumarin Drug Info [531055]
8-Bromo-6-methyl-3-phenylcoumarin Drug Info [531055]
8-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
8-Methoxy-4,9-dihydro-3H-beta-carboline Drug Info [526993]
8-[(3-Trifluoromethyl)benzyloxy]caffeine Drug Info [530647]
9-Methyl-2,3,4,9-tetrahydro-1H-beta-carboline Drug Info [526993]
AS-605240 Drug Info [531046]
Benzyl-methyl-[1-(1H-pyrrol-2-yl)-vinyl]-amine Drug Info [526566]
Butyl-methyl-prop-2-ynyl-amine hydrochloride Drug Info [526820]
C-(1H-Indol-3-yl)-methylamine Drug Info [526993]
CGS-19281A Drug Info [526994]
CHALCONE Drug Info [530087]
CHF-3381 Drug Info [536374]
Cis-2-(4-chlorophenyl)-2-fluorocyclopropanamine Drug Info [529607]
Cis-2-(para-fluorophenyl)cyclopropylamine Drug Info [529607]
Cis-2-Fluoro-2-(4-methoxyphenyl)cyclopropylamine Drug Info [529607]
Cis-2-fluoro-2-phenylcyclopropanamine Drug Info [529607]
Cis-2-phenylcyclopropylamine Drug Info [529607]
CORDOIN Drug Info [530087]
Deprenyl Drug Info [535505]
EVT-301 Drug Info [529908]
Farnesol Drug Info [551374]
Flavin-Adenine Dinucleotide Drug Info [551393]
Heptyl-methyl-prop-2-ynyl-amine hydrochloride Drug Info [526820]
HT-1067 Drug Info [549232]
HYDRAZINECARBOXAMIDE Drug Info [527283]
IPRONIAZIDE Drug Info [530675]
Isatin Drug Info [551391]
Isopropyl-methyl-prop-2-ynyl-amine hydrochloride Drug Info [526820]
Isopsoralen Drug Info [535106]
JD-0100 Drug Info [543639]
L-136662 Drug Info [531046]
Ladostigil Drug Info [531772]
Lauryl Dimethylamine-N-Oxide Drug Info [551393]
Lazabemide Drug Info [534569]
LAZEBEMIDE Drug Info [527719]
Methyl piperate Drug Info [530562]
Methyl-(1,2,3,4-tetrahydro-naphthalen-1-yl)-amine Drug Info [533451]
Methyl-pentyl-prop-2-ynyl-amine oxalic acid Drug Info [526820]
N-(1H-Indol-2-ylmethyl)-N-methyl-N-phenylamine Drug Info [529768]
N-(1H-Indol-2-ylmethyl)-N-phenylamine Drug Info [529768]
N-(2-aminoethyl)-2-oxo-2H-chromene-3-carboxamide Drug Info [530001]
N-(2-AMINOETHYL)-P-CHLOROBENZAMIDE Drug Info [551374]
N-(2-Methyl-1H-indol-5-yl)benzamide Drug Info [531067]
N-(2-Methyl-1H-indol-5-yl)cyclohexanecarboxamide Drug Info [531067]
N-(2-phenylethyl),N-(pyrrol-2-ylmethyl)amine Drug Info [528641]
N-(2-Phenylethyl)-1H-indole-2-carboxamide Drug Info [529768]
N-(3-Phenylpropyl)-1H-indole-2-carboxamide Drug Info [529768]
N-(4-Ethylphenyl)-2-oxo-2H-chromene-3-carboxamide Drug Info [530001]
N-(4-Phenylbutyl)-1H-indole-2-carboxamide Drug Info [529768]
N-(benzyl),N-(pyrrol-2-ylmethyl)amine Drug Info [528641]
N-(propargyl),N-(pyrrol-2-ylmethyl)amine Drug Info [528641]
N-Benzyl,N-methyl-1H-indole-2-carboxamide Drug Info [529768]
N-Benzyl-1H-indole-2-carboxamide Drug Info [529768]
N-benzyl-2-oxo-2H-chromene-3-carboxamide Drug Info [530001]
N-Benzyl-N-(1H-indol-2-ylmethyl)-N-methylamine Drug Info [529768]
N-cyclohexyl-2-oxo-2H-chromene-3-carboxamide Drug Info [530001]
N-isobutyl-2-oxo-2H-chromene-3-carboxamide Drug Info [530001]
N-methyl,N-(benzyl),N-(pyrrol-2-ylmethyl)amine Drug Info [528641]
N-methyl,N-(propargyl),N-(pyrrol-2-ylmethyl)amine Drug Info [528641]
N-Methyl,N-phenyl-1H-indole-2-carboxamide Drug Info [529768]
N-Methyl-N-phenyl-2-oxo-2H-chromene-3-carboxamide Drug Info [530001]
N-Methyl-N-Propargyl-1(R)-Aminoindan Drug Info [551374]
N-Phenyl-1H-indole-2-carboxamide Drug Info [529768]
N-Propargyl-1(S)-Aminoindan Drug Info [551374]
N2-[4-(benzyloxy)benzyl]glycinamide Drug Info [529025]
N2-{4-[(3-chlorobenzyl)oxy]benzyl}glycinamide Drug Info [529025]
N2-{4-[(3-fluorobenzyl)oxy]benzyl}glycinamide Drug Info [529025]
N2-{4-[(4-chlorobenzyl)oxy]benzyl}glycinamide Drug Info [529025]
N2-{4-[(4-nitrobenzyl)oxy]benzyl}glycinamide Drug Info [529025]
NSC-50187 Drug Info [530614]
NSC-50393 Drug Info [530614]
NSC-93405 Drug Info [530614]
NW-1772 Drug Info [543639]
P2B-001 Drug Info [528670]
Pargyline Drug Info [537499]
PF9601N Drug Info [536923]
Phenelzine Drug Info [536743]
Phenyl 4-(4,5-dihydro-1H-imidazol-2-yl)benzoate Drug Info [529853]
PIPERINE Drug Info [530562]
PNU-22394 Drug Info [526993]
Psoralen Drug Info [535106]
Rasagiline Drug Info [537470]
RS-1636 Drug Info [535422]
RS-1653 Drug Info [535422]
RWJ-416457 Drug Info [543639]
Safinamide Drug Info [536266], [536498]
Selegiline Drug Info [543639]
SKL-PD Drug Info [543639]
SL-25.1188 Drug Info [530356]
TOLOXATONE Drug Info [526287]
TRACIZOLINE Drug Info [526918]
Trans-2-(4-chlorophenyl)-2-fluorocyclopropanamine Drug Info [529607]
Trans-2-fluoro-2-(4-fluorophenyl)cyclopropanamine Drug Info [529607]
Trans-2-fluoro-2-p-tolylcyclopropanamine Drug Info [529607]
Trans-2-fluoro-2-phenylcyclopropylamin Drug Info [529607]
Tranylcypromine Drug Info [536265], [537851]
TRYPTAMINE Drug Info [526993]
TRYPTOLINE Drug Info [526918]
VAR-10300 Drug Info [543639]
Zydis selegiline Drug Info [536266]
[(1e)-4-Phenylbut-1-Enyl]Benzene Drug Info [551374]
Modulator 4-fluoroselegiline Drug Info [533786]
Indeloxazine Drug Info [551871]
LU-53439 Drug Info
Milacemide Drug Info [530942]
MOFEGILINE Drug Info [529842]
Neu-120 Drug Info
RG1577 Drug Info [550238]
Selegiline Hydrochloride Drug Info [556264]
VAR-10200 Drug Info [543639]
Antagonist 4-Methoxyamphetamine Drug Info [551380]
MMDA Drug Info [551393]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
BioCyc Pathway Superpathway of tryptophan utilization
Tryptophan degradation via tryptamine
Dopamine degradation
Putrescine degradation III
Noradrenaline and adrenaline degradation
KEGG Pathway Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
PANTHER Pathway Adrenaline and noradrenaline biosynthesis
5-Hydroxytryptamine degredation
Dopamine receptor mediated signaling pathway
Pathway Interaction Database Alpha-synuclein signaling
WikiPathways Tryptophan metabolism
Dopamine metabolism
Phase 1 - Functionalization of compounds
References
Ref 521730ClinicalTrials.gov (NCT00227136) Effect of Oral 5-HTP Intake on Urinary 5-HIAA Excretion. U.S. National Institutes of Health.
Ref 522217ClinicalTrials.gov (NCT00607451) Safety, Tolerability, PK and PD Study of Neu-120 in the Treatment of Levodopa-induced Dyskinesia. U.S. National Institutes of Health.
Ref 522265ClinicalTrials.gov (NCT00640159) Tolerability and Efficacy of Switch From Oral Selegiline to Orally Disintegrating Selegiline (Zelapar) in Patients With Parkinson's Disease. U.S. National Institutes of Health.
Ref 523529ClinicalTrials.gov (NCT01383694) Effect Of Piperine In Patients With Oropharyngeal Dysphagia. U.S. National Institutes of Health.
Ref 524054ClinicalTrials.gov (NCT01686594) PUVA Maintenance Therapy in Mycosis Fungoides. U.S. National Institutes of Health.
Ref 524487ClinicalTrials.gov (NCT01968460) Safety, Tolerability and Efficacy of Two Doses of Once Daily P2B001 in Subjects With Early Parkinson's Disease. U.S. National Institutes of Health.
Ref 529017Indantadol, a novel NMDA antagonist and nonselective MAO inhibitor for the potential treatment of neuropathic pain. IDrugs. 2007 Sep;10(9):636-44.
Ref 529304CYP-dependent metabolism of PF9601N, a new monoamine oxidase-B inhibitor, by C57BL/6 mouse and human liver microsomes. J Pharm Pharm Sci. 2007;10(4):473-85.
Ref 530942Milacemide, the selective substrate and enzyme-activated specific inhibitor of monoamine oxidase B, increases dopamine but not serotonin in caudate nucleus of rhesus monkey. Neurochem Int. 1990;17(2):325-9.
Ref 531772Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94.
Ref 536285Novel pharmacological targets for the treatment of Parkinson's disease. Nat Rev Drug Discov. 2006 Oct;5(10):845-54.
Ref 536374Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
Ref 536923Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42.
Ref 538452FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 011909.
Ref 538764(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 125).
Ref 539613(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2489).
Ref 541748(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6639).
Ref 541750(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6640).
Ref 541751(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6641).
Ref 542285(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7266).
Ref 543044(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8291).
Ref 545271Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002656)
Ref 545650Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004032)
Ref 547083Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012921)
Ref 547487Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016773)
Ref 548293Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024230)
Ref 548499Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800026046)
Ref 549231Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034020)
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 889446Drugs@FDA (Edaravone)
Ref 526287J Med Chem. 2002 Mar 14;45(6):1180-3.3-(1H-Pyrrol-1-yl)-2-oxazolidinones as reversible, highly potent, and selective inhibitors of monoamine oxidase type A.
Ref 526566J Med Chem. 2003 Mar 13;46(6):917-20.Simple, potent, and selective pyrrole inhibitors of monoamine oxidase types A and B.
Ref 526820J Med Chem. 1992 Oct 2;35(20):3705-13.Aliphatic propargylamines: potent, selective, irreversible monoamine oxidase B inhibitors.
Ref 526918Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9.Binding of an imidazopyridoindole at imidazoline I2 receptors.
Ref 526993Bioorg Med Chem Lett. 2004 Feb 23;14(4):999-1002.Binding of beta-carbolines at imidazoline I2 receptors: a structure-affinity investigation.
Ref 526994Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5.Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands.
Ref 527283J Med Chem. 2004 Nov 18;47(24):5860-71.Fluorinated phenylcyclopropylamines. 2. Effects of aromatic ring substitution and of absolute configuration on inhibition of microbial tyramine oxidase.
Ref 527719Bioorg Med Chem Lett. 2005 Oct 15;15(20):4438-46.Docking studies on monoamine oxidase-B inhibitors: estimation of inhibition constants (K(i)) of a series of experimentally tested compounds.
Ref 528409J Med Chem. 2006 Sep 7;49(18):5578-86.3-[5-(4,5-dihydro-1H-imidazol-2-yl)-furan-2-yl]phenylamine (Amifuraline), a promising reversible and selective peripheral MAO-A inhibitor.
Ref 528641J Med Chem. 2007 Mar 8;50(5):922-31. Epub 2007 Jan 26.New pyrrole inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity.
Ref 528670Rasagiline (TVP-1012): a new selective monoamine oxidase inhibitor for Parkinson's disease. Am J Geriatr Pharmacother. 2006 Dec;4(4):330-46.
Ref 528855Bioorg Med Chem. 2007 Aug 1;15(15):5198-206. Epub 2007 May 22.Human and rat monoamine oxidase-A are differentially inhibited by (S)-4-alkylthioamphetamine derivatives: insights from molecular modeling studies.
Ref 529025J Med Chem. 2007 Oct 4;50(20):4909-16. Epub 2007 Sep 7.Solid-phase synthesis and insights into structure-activity relationships of safinamide analogues as potent and selective inhibitors of type B monoamine oxidase.
Ref 529077J Med Chem. 2007 Nov 1;50(22):5364-71. Epub 2007 Oct 2.Synthesis and monoamine oxidase inhibitory activity of new pyridazine-, pyrimidine- and 1,2,4-triazine-containing tricyclic derivatives.
Ref 529080J Med Chem. 2007 Nov 15;50(23):5848-52. Epub 2007 Oct 4.Structures of human monoamine oxidase B complexes with selective noncovalent inhibitors: safinamide and coumarin analogs.
Ref 529607Bioorg Med Chem. 2008 Aug 1;16(15):7148-66. Epub 2008 Jun 28.Fluorinated phenylcyclopropylamines. Part 5: Effects of electron-withdrawing or -donating aryl substituents on the inhibition of monoamine oxidases A and B by 2-aryl-2-fluoro-cyclopropylamines.
Ref 529735J Med Chem. 2008 Nov 13;51(21):6740-51. Epub 2008 Oct 4.Quantitative structure-activity relationship and complex network approach to monoamine oxidase A and B inhibitors.
Ref 529768Bioorg Med Chem. 2008 Nov 15;16(22):9729-40. Epub 2008 Oct 2.Synthesis, structure-activity relationships and molecular modeling studies of new indole inhibitors of monoamine oxidases A and B.
Ref 529842J Med Chem. 2008 Dec 25;51(24):8019-26.Structural and mechanistic studies of mofegiline inhibition of recombinant human monoamine oxidase B.
Ref 529853Bioorg Med Chem Lett. 2009 Jan 15;19(2):546-9. Epub 2008 Mar 6.Ultrasound promoted synthesis of 2-imidazolines in water: a greener approach toward monoamine oxidase inhibitors.
Ref 529873Bioorg Med Chem. 2009 Jan 15;17(2):675-89. Epub 2008 Dec 3.New pyrazoline bearing 4(3H)-quinazolinone inhibitors of monoamine oxidase: synthesis, biological evaluation, and structural determinants of MAO-A and MAO-B selectivity.
Ref 529908Assessment of MAO-B occupancy in the brain with PET and [11C]-L-deprenyl-D2: a dose-finding study with a novel MAO-B inhibitor, EVT 301. Clin Pharmacol Ther. 2009 May;85(5):506-12.
Ref 529986Bioorg Med Chem. 2009 Mar 15;17(6):2452-60. Epub 2009 Feb 8.Naphthylisopropylamine and N-benzylamphetamine derivatives as monoamine oxidase inhibitors.
Ref 530001J Med Chem. 2009 Apr 9;52(7):1935-42.Synthesis, molecular modeling, and selective inhibitory activity against human monoamine oxidases of 3-carboxamido-7-substituted coumarins.
Ref 530056Bioorg Med Chem Lett. 2009 May 1;19(9):2509-13. Epub 2009 Mar 14.Inhibition of monoamine oxidase by (E)-styrylisatin analogues.
Ref 530087J Med Chem. 2009 May 14;52(9):2818-24.Chalcones: a valid scaffold for monoamine oxidases inhibitors.
Ref 530273Bioorg Med Chem Lett. 2009 Sep 1;19(17):5053-5. Epub 2009 Jul 10.Synthesis and evaluation of 6-methyl-3-phenylcoumarins as potent and selective MAO-B inhibitors.
Ref 530356[(11)C]SL25.1188, a new reversible radioligand to study the monoamine oxidase type B with PET: preclinical characterisation in nonhuman primate. Synapse. 2010 Jan;64(1):61-9.
Ref 530425Bioorg Med Chem. 2009 Nov 1;17(21):7523-30. Epub 2009 Sep 15.Synthesis and in vitro evaluation of pteridine analogues as monoamine oxidase B and nitric oxide synthase inhibitors.
Ref 530434J Med Chem. 2009 Nov 12;52(21):6685-706.Discovery of a novel class of potent coumarin monoamine oxidase B inhibitors: development and biopharmacological profiling of 7-[(3-chlorobenzyl)oxy]-4-[(methylamino)methyl]-2H-chromen-2-one methanesulfonate (NW-1772) as a highly potent, selective, reversible, and orally active monoamine oxidase B inhibitor.
Ref 530562Bioorg Med Chem Lett. 2010 Jan 15;20(2):537-40. Epub 2009 Nov 26.Proposed structural basis of interaction of piperine and related compounds with monoamine oxidases.
Ref 530614Bioorg Med Chem. 2010 Feb;18(3):1273-9. Epub 2010 Jan 4.A new series of flavones, thioflavones, and flavanones as selective monoamine oxidase-B inhibitors.
Ref 530647Bioorg Med Chem. 2010 Feb;18(3):1018-28. Epub 2010 Jan 6.Inhibition of monoamine oxidase by 8-benzyloxycaffeine analogues.
Ref 530675Bioorg Med Chem. 2010 Feb 15;18(4):1659-64. Epub 2010 Jan 4.Design of novel nicotinamides as potent and selective monoamine oxidase a inhibitors.
Ref 530683Bioorg Med Chem. 2010 Feb 15;18(4):1388-95. Epub 2010 Jan 15.2-Arylthiomorpholine derivatives as potent and selective monoamine oxidase B inhibitors.
Ref 530841Bioorg Med Chem Lett. 2010 May 1;20(9):2709-12. Epub 2010 Mar 27.Chromone-2- and -3-carboxylic acids inhibit differently monoamine oxidases A and B.
Ref 530942Milacemide, the selective substrate and enzyme-activated specific inhibitor of monoamine oxidase B, increases dopamine but not serotonin in caudate nucleus of rhesus monkey. Neurochem Int. 1990;17(2):325-9.
Ref 531046Bioorg Med Chem Lett. 2010 Sep 1;20(17):5295-8. Epub 2010 Jul 1.Identification of novel monoamine oxidase B inhibitors by structure-based virtual screening.
Ref 531055Bioorg Med Chem Lett. 2010 Sep 1;20(17):5157-60. Epub 2010 Jul 8.New halogenated 3-phenylcoumarins as potent and selective MAO-B inhibitors.
Ref 531067Eur J Med Chem. 2010 Oct;45(10):4458-66. Epub 2010 Jul 31.Inhibition of monoamine oxidase by indole and benzofuran derivatives.
Ref 531772Ladostigil: a novel multimodal neuroprotective drug with cholinesterase and brain-selective monoamine oxidase inhibitory activities for Alzheimer's disease treatment. Curr Drug Targets. 2012 Apr;13(4):483-94.
Ref 533451J Med Chem. 1988 Aug;31(8):1558-66.Stereoisomers of allenic amines as inactivators of monoamine oxidase type B. Stereochemical probes of the active site.
Ref 533786Multiple, small dose administration of (-)deprenyl enhances catecholaminergic activity and diminishes serotoninergic activity in the brain and these effects are unrelated to MAO-B inhibition. Arch Int Pharmacodyn Ther. 1994 Jul-Aug;328(1):1-15.
Ref 534569The activity of MAO A and B in rat renal cells and tubules. Life Sci. 1998;62(8):727-37.
Ref 535106Inhibition of rat brain monoamine oxidase activities by psoralen and isopsoralen: implications for the treatment of affective disorders. Pharmacol Toxicol. 2001 Feb;88(2):75-80.
Ref 535422Novel monoamine oxidase inhibitors, 3-(2-aminoethoxy)-1,2-benzisoxazole derivatives, and their differential reversibility. Jpn J Pharmacol. 2002 Feb;88(2):174-82.
Ref 535505The effect of deprenyl washout in patients with long-standing Parkinson's disease. J Neural Transm. 2002 May;109(5-6):797-803.
Ref 536265Tranylcypromine: new perspectives on an "old" drug. Eur Arch Psychiatry Clin Neurosci. 2006 Aug;256(5):268-73.
Ref 536266Emerging drugs for Parkinson's disease. Expert Opin Emerg Drugs. 2006 Sep;11(3):403-17.
Ref 536374Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
Ref 536498Emerging drugs for epilepsy. Expert Opin Emerg Drugs. 2007 Sep;12(3):407-22.
Ref 536743Limitation of adipose tissue enlargement in rats chronically treated with semicarbazide-sensitive amine oxidase and monoamine oxidase inhibitors. Pharmacol Res. 2008 Jun;57(6):426-34. Epub 2008 Apr 24.
Ref 536923Drugs used to treat Parkinson's disease, present status and future directions. CNS Neurol Disord Drug Targets. 2008 Oct;7(4):321-42.
Ref 537470Glyceraldehyde-3-Phosphate Dehydrogenase-Monoamine Oxidase B-Mediated Cell Death-Induced by Ethanol is Prevented by Rasagiline and 1-R-Aminoindan. Neurotox Res. 2009 Aug;16(2):148-59. Epub 2009 May 28.
Ref 537499Dose-dependent activation of distinct hypertrophic pathways by serotonin in cardiac cells. Am J Physiol Heart Circ Physiol. 2009 Aug;297(2):H821-8. Epub 2009 Jun 19.
Ref 537851Dopamine D2 receptors: a potential pharmacological target for nomifensine and tranylcypromine but not other antidepressant treatments. Pharmacol Biochem Behav. 1995 Aug;51(4):565-9.
Ref 543639(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2490).
Ref 549232Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034020)
Ref 550238Sembragiline Alzheimer's Disease (Phase 2). Evotech AG, Roche.
Ref 551222Synthesis, semipreparative HPLC separation, biological evaluation, and 3D-QSAR of hydrazothiazole derivatives as human monoamine oxidase B inhibitors. Bioorg Med Chem. 2010 Jul 15;18(14):5063-70. doi: 10.1016/j.bmc.2010.05.070. Epub 2010 Jun 1.
Ref 551346Further explorations of unnatural alkaloids. J Nat Prod. 1985 Nov-Dec;48(6):878-93.
Ref 551374The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
Ref 551380Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77.
Ref 551391DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.