Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T43189
|
||||
Former ID |
TTDS00271
|
||||
Target Name |
Tubulin
|
||||
Gene Name |
TUBB3
|
||||
Synonyms |
Tubulin beta-4 chain; Tubulin beta-III; TUBB3
|
||||
Target Type |
Successful
|
||||
Disease | Acute gouty arthritis [ICD9: 274; ICD10: M10] | ||||
Actinic keratosis [ICD9: 702; ICD10: L57.0] | |||||
Advanced sarcomar [ICD10: C96.4] | |||||
Advanced breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
Breast cancer; Ovarian cancer [ICD9: 174, 175, 183; ICD10: C50, C56] | |||||
Breast cancer [ICD9: 174, 175; ICD10: C50] | |||||
Breast cancer; Prostate cancer [ICD9:174, 175, 185; ICD10: C50, C61] | |||||
Central nervous system disease [ICD10: G00-G99] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Immuno-suppressant [ICD10: T86.0] | |||||
Ovarian cancer [ICD9: 183; ICD10: C56] | |||||
Pancreatic cancer; Bladder cancer [ICD9: 188; ICD10: C25, C67] | |||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Function |
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain. TUBB3 plays a critical role in proper axon guidance and mantainance.
|
||||
BioChemical Class |
Tubulin family
|
||||
Target Validation |
T43189
|
||||
UniProt ID | |||||
Sequence |
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYV
PRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVV RKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVV EPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSL RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMM AACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRG LKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS EYQQYQDATAEEEGEMYEDDEEESEAQGPK |
||||
Drugs and Mode of Action | |||||
Drug(s) | Cabazitaxel | Drug Info | Approved | Breast cancer; Prostate cancer | [531351], [541879] |
Colchicine | Drug Info | Approved | Acute gouty arthritis | [538354], [542532], [551871] | |
Docetaxel | Drug Info | Approved | Cancer | [536361], [541891] | |
Eribulin | Drug Info | Approved | Breast cancer | [531351], [541895] | |
Ixabepilone | Drug Info | Approved | Advanced breast cancer | [529282], [531351], [541906] | |
Vinorelbine | Drug Info | Approved | Cancer | [536361], [542112] | |
Epothilon | Drug Info | Phase 3 | Breast cancer; Ovarian cancer | [536839] | |
BMS-184476 | Drug Info | Phase 2 | Cancer | [527405] | |
BMS-188797 | Drug Info | Phase 2 | Cancer | [521476], [527913] | |
BMS-275183 | Drug Info | Phase 2 | Cancer | [521864] | |
Cabazitaxel | Drug Info | Phase 2 | Solid tumours | [531351], [541879] | |
CRYPTOPHYCIN 52 | Drug Info | Phase 2 | Cancer | [526539] | |
DOLASTATIN-10 | Drug Info | Phase 2 | Cancer | [521453] | |
Indibulin | Drug Info | Phase 2 | Advanced sarcomar | [551789] | |
Milataxel | Drug Info | Phase 2 | Cancer | [522328] | |
Soblidotin | Drug Info | Phase 2 | Cancer | [521565] | |
E 7974 | Drug Info | Phase 1 | Ovarian cancer | [536839] | |
SDZ-LAV-694 | Drug Info | Phase 1 | Actinic keratosis | [530311] | |
ABI-013 | Drug Info | Preclinical | Cancer | [549895] | |
Epothilone B | Drug Info | Discontinued in Phase 3 | Cancer | [546007] | |
Larotaxel | Drug Info | Discontinued in Phase 3 | Pancreatic cancer; Bladder cancer | [546774] | |
ATX-201 | Drug Info | Discontinued in Phase 2 | Actinic keratosis | [548552] | |
Cryptophycin | Drug Info | Discontinued in Phase 2 | Discovery agent | [545698] | |
ERBULOZOLE | Drug Info | Discontinued in Phase 2 | Cancer | [545429] | |
RHIZOXIN | Drug Info | Discontinued in Phase 2 | Breast cancer | [544988] | |
ABJ-879 | Drug Info | Discontinued in Phase 1 | Cancer | [547922] | |
Discodermolide | Drug Info | Discontinued in Phase 1 | Immuno-suppressant | [546438] | |
FCE-28161 | Drug Info | Discontinued in Phase 1 | Cancer | [546352] | |
TALTOBULIN | Drug Info | Discontinued in Phase 1 | Cancer | [547769] | |
21-AMINOEPOTHILONE B | Drug Info | Terminated | Cancer | [547539] | |
Docetaxel | Drug Info | Investigative | Cancer | [536155] | |
Inhibitor | 2-(3-Chloro-phenyl)-1H-[1,8]naphthyridin-4-one | Drug Info | [534469] | ||
2-(4-Methoxy-phenyl)-1H-indole-3-carbaldehyde | Drug Info | [534765] | |||
2-Furan-2-yl-7-methyl-1H-[1,8]naphthyridin-4-one | Drug Info | [525604] | |||
2-m-Tolyl-1H-[1,8]naphthyridin-4-one | Drug Info | [534469] | |||
2-Methoxy-5-(3,4,5-trimethoxy-benzyl)-phenol | Drug Info | [527276] | |||
2-Methoxy-5-(3,4,5-trimethoxy-phenoxy)-phenol | Drug Info | [525946] | |||
2-Methoxy-5-(5,6,7-trimethoxy-indan-1-yl)-phenol | Drug Info | [525450] | |||
2-Naphthalen-1-yl-1H-[1,8]naphthyridin-4-one | Drug Info | [534469] | |||
2-Naphthalen-2-yl-1H-[1,8]naphthyridin-4-one | Drug Info | [534469] | |||
21-AMINOEPOTHILONE B | Drug Info | [544107], [551871] | |||
5,7-Dimethyl-2-m-tolyl-1H-[1,8]naphthyridin-4-one | Drug Info | [534469] | |||
5-Methyl-2-m-tolyl-1H-[1,8]naphthyridin-4-one | Drug Info | [534469] | |||
6-Methyl-2-m-tolyl-1H-[1,8]naphthyridin-4-one | Drug Info | [534469] | |||
7-Methyl-2-m-tolyl-1H-[1,8]naphthyridin-4-one | Drug Info | [534469] | |||
ATX-201 | Drug Info | [551080] | |||
BMS-184476 | Drug Info | [544055], [551871] | |||
BMS-188797 | Drug Info | [526881], [551871] | |||
BMS-275183 | Drug Info | [531077] | |||
Cabazitaxel | Drug Info | [531351] | |||
CENTAUREIDIN | Drug Info | [534652] | |||
COLCHINOL | Drug Info | [527777] | |||
COMBETASTATIN | Drug Info | [534795] | |||
CRYPTOPHYCIN 52 | Drug Info | [526539], [551871] | |||
Docetaxel | Drug Info | [536155] | |||
DOLASTATIN-10 | Drug Info | [534612] | |||
E 7974 | Drug Info | [536839] | |||
Epothilone B | Drug Info | [537114] | |||
Eribulin | Drug Info | [531351] | |||
GNF-PF-117 | Drug Info | [534009] | |||
Isopropyl 3-(phenylthio)-1H-indole-2-carboxylate | Drug Info | [527999] | |||
Larotaxel | Drug Info | [549823] | |||
Milataxel | Drug Info | [549708] | |||
MR-22388 | Drug Info | [526982] | |||
MYOSEVERIN | Drug Info | [526222] | |||
NSC-106970 | Drug Info | [534652] | |||
NSC-664171 | Drug Info | [534600] | |||
NSC-679036 | Drug Info | [534469] | |||
PHENSTATIN | Drug Info | [526346] | |||
RHIZOXIN | Drug Info | [528337] | |||
SDZ-LAV-694 | Drug Info | [551570], [551871] | |||
TALTOBULIN | Drug Info | [530691], [551871] | |||
THIOCOLCHICINE | Drug Info | [534060] | |||
Vinorelbine | Drug Info | [536782] | |||
WR85915 | Drug Info | [535074] | |||
Modulator | ABJ-879 | Drug Info | [528961] | ||
AL-209 | Drug Info | [531541] | |||
AL-309 | Drug Info | [531541] | |||
Discodermolide | Drug Info | [534515] | |||
ERBULOZOLE | Drug Info | [533220], [551871] | |||
FCE-28161 | Drug Info | [550854], [551871] | |||
Soblidotin | Drug Info | [528298] | |||
Binder | Colchicine | Drug Info | [537471] | ||
Inducer | Cryptophycin | Drug Info | [536415] | ||
Eleutherobin | Drug Info | [538088] | |||
Sarcodictyin A | Drug Info | [534859] | |||
Stablizer | Epothilon | Drug Info | [536839] | ||
Indibulin | Drug Info | [551789] | |||
Ixabepilone | Drug Info | [531351] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
References | |||||
Ref 521453 | ClinicalTrials.gov (NCT00003677) Dolastatin 10 in Treating Patients With Metastatic Pancreatic Cancer. U.S. National Institutes of Health. | ||||
Ref 521476 | ClinicalTrials.gov (NCT00006086) BMS-188797 and Carboplatin in Treating Patients With Advanced Nonhematologic Cancer. U.S. National Institutes of Health. | ||||
Ref 521565 | ClinicalTrials.gov (NCT00064220) Soblidotin in Treating Patients With Advanced or Metastatic Soft Tissue Sarcoma. U.S. National Institutes of Health. | ||||
Ref 521864 | ClinicalTrials.gov (NCT00359450) Study of BMS-275183 in Patients With Pretreated Locally Advanced or Metastatic NSCLC (Non Small Cell Lung Cancer). U.S. National Institutes of Health. | ||||
Ref 522328 | ClinicalTrials.gov (NCT00685204) An Efficacy Study of Milataxel (TL139) Administered Orally for Malignant Mesothelioma. U.S. National Institutes of Health. | ||||
Ref 526539 | Phase 2 study of cryptophycin 52 (LY355703) in patients previously treated with platinum based chemotherapy for advanced non-small cell lung cancer. Lung Cancer. 2003 Feb;39(2):197-9. | ||||
Ref 527405 | Phase II trial of the novel taxane BMS-184476 as second-line in non-small-cell lung cancer. Ann Oncol. 2005 Apr;16(4):597-601. Epub 2005 Jan 31. | ||||
Ref 527913 | A phase I and pharmacokinetic study of novel taxane BMS-188797 and cisplatin in patients with advanced solid tumours. Br J Cancer. 2006 Jan 16;94(1):79-84. | ||||
Ref 530311 | Recent patents reveal microtubules as persistent promising target for novel drug development for cancers. Recent Pat Antiinfect Drug Discov. 2009 Nov;4(3):164-82. | ||||
Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
Ref 538354 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 084279. | ||||
Ref 541879 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6798). | ||||
Ref 541891 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6809). | ||||
Ref 541895 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6813). | ||||
Ref 541906 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6824). | ||||
Ref 542112 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7105). | ||||
Ref 542532 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7526). | ||||
Ref 544988 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001808) | ||||
Ref 545429 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003227) | ||||
Ref 545698 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004253) | ||||
Ref 546007 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800005849) | ||||
Ref 546352 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007669) | ||||
Ref 546438 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008133) | ||||
Ref 546774 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010227) | ||||
Ref 547539 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017146) | ||||
Ref 547769 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019128) | ||||
Ref 547922 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020424) | ||||
Ref 525450 | Bioorg Med Chem Lett. 1999 Feb 8;9(3):407-12.The synthesis and evaluation of temperature sensitive tubulin toxins. | ||||
Ref 525604 | J Med Chem. 1999 Oct 7;42(20):4081-7.Antitumor agents. 196. Substituted 2-thienyl-1,8-naphthyridin-4-ones: their synthesis, cytotoxicity, and inhibition of tubulin polymerization. | ||||
Ref 525946 | Bioorg Med Chem Lett. 2001 Jan 8;11(1):51-4.Antimitotic and cell growth inhibitory properties of combretastatin A-4-like ethers. | ||||
Ref 526222 | J Med Chem. 2001 Dec 20;44(26):4497-500.Synthesis and biological evaluation of myoseverin derivatives: microtubule assembly inhibitors. | ||||
Ref 526346 | J Med Chem. 2002 Jun 6;45(12):2534-42.Antineoplastic agents. 465. Structural modification of resveratrol: sodium resverastatin phosphate. | ||||
Ref 526539 | Phase 2 study of cryptophycin 52 (LY355703) in patients previously treated with platinum based chemotherapy for advanced non-small cell lung cancer. Lung Cancer. 2003 Feb;39(2):197-9. | ||||
Ref 526881 | Phase I and pharmacokinetic study of BMS-188797, a new taxane analog, administered on a weekly schedule in patients with advanced malignancies. Clin Cancer Res. 2003 Nov 1;9(14):5187-94. | ||||
Ref 526982 | J Med Chem. 2004 Mar 11;47(6):1448-64.Design, synthesis, and evaluation of novel thienopyrrolizinones as antitubulin agents. | ||||
Ref 527276 | J Med Chem. 1992 Mar 20;35(6):1058-67.Synthesis of alkoxy-substituted diaryl compounds and correlation of ring separation with inhibition of tubulin polymerization: differential enhancement of inhibitory effects under suboptimal polymerization reaction conditions. | ||||
Ref 527777 | Bioorg Med Chem Lett. 2005 Dec 1;15(23):5154-9. Epub 2005 Sep 28.Synthesis and structure-activity relationships of 1,2,4-triazoles as a novel class of potent tubulin polymerization inhibitors. | ||||
Ref 527999 | J Med Chem. 2006 Feb 9;49(3):947-54.New arylthioindoles: potent inhibitors of tubulin polymerization. 2. Structure-activity relationships and molecular modeling studies. | ||||
Ref 528337 | Bioorg Med Chem Lett. 2006 Sep 15;16(18):4748-51. Epub 2006 Jul 25.Tubulin polymerization inhibitors with a fluorinated phthalimide skeleton derived from thalidomide. | ||||
Ref 528961 | Novel tubulin-targeting agents: anticancer activity and pharmacologic profile of epothilones and related analogues. Ann Oncol. 2007 Jul;18 Suppl 5:v9-15. | ||||
Ref 530691 | Absolute configurations of tubulin inhibitors taltobulin (HTI-286) and HTI-042 characterized by X-ray diffraction analysis and NMR studies. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1535-8. | ||||
Ref 531077 | A phase 1 study of BMS-275183, a novel oral analogue of paclitaxel given on a daily schedule to patients with advanced malignancies. Invest New Drugs. 2011 Dec;29(6):1426-31. | ||||
Ref 531541 | Protection against tauopathy by the drug candidates NAP (davunetide) and D-SAL: biochemical, cellular and behavioral aspects. Curr Pharm Des. 2011;17(25):2603-12. | ||||
Ref 533220 | Influence of the synthetic microtubule inhibitor erbulozole (P.I.N.N.) (R 55 104), a new tubulozole congener, and gamma irradiation on murine tumors in vivo. Eur J Cancer Clin Oncol. 1989 Oct;25(10):1499-504. | ||||
Ref 534009 | J Med Chem. 1993 Apr 30;36(9):1146-56.Synthesis and cytotoxicity of 1,6,7,8-substituted 2-(4'-substituted phenyl)-4-quinolones and related compounds: identification as antimitotic agents interacting with tubulin. | ||||
Ref 534060 | J Med Chem. 1993 Mar 5;36(5):544-51.Antitumor agents. 139. Synthesis and biological evaluation of thiocolchicine analogs 5,6-dihydro-6(S)-(acyloxy)- and 5,6-dihydro-6(S)-[(aroyloxy)methyl]-1,2,3-trimethoxy-9-(methylthio)-8H- cyclohepta[a]naphthalen-8-ones as novel cytotoxic and antimitotic agents. | ||||
Ref 534469 | J Med Chem. 1997 Sep 12;40(19):3049-56.Antitumor agents. 178. Synthesis and biological evaluation of substituted 2-aryl-1,8-naphthyridin-4(1H)-ones as antitumor agents that inhibit tubulin polymerization. | ||||
Ref 534515 | The microtubule-stabilizing agent discodermolide competitively inhibits the binding of paclitaxel (Taxol) to tubulin polymers, enhances tubulin nucleation reactions more potently than paclitaxel, andinhibits the growth of paclitaxel-resistant cells. Mol Pharmacol. 1997 Oct;52(4):613-22. | ||||
Ref 534600 | J Med Chem. 1998 Mar 26;41(7):1155-62.Antitumor agents. 181. Synthesis and biological evaluation of 6,7,2',3',4'-substituted-1,2,3,4-tetrahydro-2-phenyl-4-quinolones as a new class of antimitotic antitumor agents. | ||||
Ref 534612 | J Med Chem. 1998 Apr 23;41(9):1524-30.Synthesis and biological activity of chimeric structures derived from the cytotoxic natural compounds dolastatin 10 and dolastatin 15. | ||||
Ref 534652 | J Med Chem. 1998 Jun 18;41(13):2333-8.Structure-activity requirements for flavone cytotoxicity and binding to tubulin. | ||||
Ref 534765 | J Med Chem. 1998 Dec 3;41(25):4965-72.Methoxy-substituted 3-formyl-2-phenylindoles inhibit tubulin polymerization. | ||||
Ref 534795 | Bioorg Med Chem Lett. 1998 Aug 4;8(15):1997-2000.Asymmetric synthesis of antimitotic combretadioxolane with potent antitumor activity against multi-drug resistant cells. | ||||
Ref 534859 | The coral-derived natural products eleutherobin and sarcodictyins A and B: effects on the assembly of purified tubulin with and without microtubule-associated proteins and binding at the polymer taxoid site. Biochemistry. 1999 Apr 27;38(17):5490-8. | ||||
Ref 535074 | Cellular effects of leishmanial tubulin inhibitors on L. donovani. Mol Biochem Parasitol. 2000 Oct;110(2):223-36. | ||||
Ref 537471 | Vitamin K3 disrupts the microtubule networks by binding to tubulin: a novel mechanism of its antiproliferative activity. Biochemistry. 2009 Jul 28;48(29):6963-74. | ||||
Ref 538088 | Eleutherobin, a novel cytotoxic agent that induces tubulin polymerization, is similar to paclitaxel (Taxol). Cancer Res. 1998 Mar 15;58(6):1111-5. | ||||
Ref 544055 | Phase I trial of the novel taxane BMS-184476 administered in combination with carboplatin every 21 days. Br J Cancer. 2004 July 19; 91(2): 213-218. | ||||
Ref 544107 | Tubulin-Interactive Natural Products as Anticancer Agents. Correction in: J Nat Prod. 2011 May 27; 74(5): 1352. | ||||
Ref 549756 | Cardiovascular and CNS safety profile of ABI-013, a novel nanoparticle albumin-bound (nab) analog of docetaxel. Cancer Research. 01/2011; 70(8 Supplement):2617-2617. | ||||
Ref 550854 | CN patent application no. 101065129, A combination of n-(3-metoxy-5-methylpyrazin-2-yl)-2-(4-[1,3,4-oxadiazol-2-yl]phenyl)pyridine-3-sulphonamide and an anti-mitotic agent for the treatment of cancer. | ||||
Ref 551080 | Clinical pipeline report, company report or official report of Kythera Biopharmaceuticals. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.