Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T76369
|
||||
Former ID |
TTDR00274
|
||||
Target Name |
Liver carboxylesterase
|
||||
Gene Name |
CES1
|
||||
Synonyms |
ACAT; Acyl coenzyme A:cholesterol acyltransferase; Brain carboxylesterase hBr1; HCE1; HMSE; Human carboxylesterase 1; Monocyte/macrophage serine esterase; Serine esterase 1; CES1
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Arteriosclerosis [ICD9: 440; ICD10: I70] | ||||
Atherosclerosis [ICD9: 414.0, 440; ICD10: I70] | |||||
Acute lymphoblastic leukemia [ICD9: 204.0, 556; ICD10: C91.0] | |||||
Hyperlipidaemia [ICD9: 272.0-272.4; ICD10: E78] | |||||
Hypercholesterolemia [ICD10: E78] | |||||
Peripheral vascular disease [ICD9: 443.9; ICD10: I73.9] | |||||
Function |
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Hydrolyzes aromatic and aliphatic esters, but has no catalytic activity toward amides or a fatty acyl coa ester.
|
||||
BioChemical Class |
Carboxylic ester hydrolase
|
||||
Target Validation |
T76369
|
||||
UniProt ID | |||||
EC Number |
EC 3.1.1.56
|
||||
Sequence |
MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPL
GPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLN IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST GDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLK MKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP MQLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDL IADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPF LKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLK DKEVAFWTNLFAKKAVEKPPQTEHIEL |
||||
Drugs and Mode of Action | |||||
Drug(s) | Cholic Acid | Drug Info | Approved | Peroxisomal disorders; Synthesis disorders | [1] |
PACTIMIBE | Drug Info | Phase 2/3 | Arteriosclerosis | [2] | |
Eldacimibe | Drug Info | Phase 2 | Hyperlipidaemia | [3] | |
K-604 | Drug Info | Phase 2 | Arteriosclerosis | [4] | |
GR148672X | Drug Info | Clinical trial | Acute lymphoblastic leukemia | [5] | |
HL-004 | Drug Info | Preclinical | Arteriosclerosis | [6] | |
Avasimibe | Drug Info | Discontinued in Phase 3 | Peripheral vascular disease | [7] | |
CI-976 | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [8] | |
CL-283796 | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [9] | |
E-5324 | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [10] | |
Eflucimibe | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [11] | |
RP-64477 | Drug Info | Discontinued in Phase 2 | Hyperlipidaemia | [12] | |
447C88 | Drug Info | Discontinued in Phase 1 | Hyperlipidaemia | [13] | |
CL-277082 | Drug Info | Discontinued in Phase 1 | Arteriosclerosis | [14] | |
F-1394 | Drug Info | Discontinued in Phase 1 | Arteriosclerosis | [15] | |
YM-17E | Drug Info | Discontinued in Phase 1 | Hyperlipidaemia | [16] | |
YM-750 | Drug Info | Discontinued in Phase 1 | Hyperlipidaemia | [17] | |
CEB-925 | Drug Info | Terminated | Hypercholesterolemia | [18] | |
CI-999 | Drug Info | Terminated | Arteriosclerosis | [19] | |
DuP-129 | Drug Info | Terminated | Hypercholesterolemia | [20] | |
FR-129169 | Drug Info | Terminated | Arteriosclerosis | [21] | |
FR-145237 | Drug Info | Terminated | Arteriosclerosis | [22] | |
Lecimibide | Drug Info | Terminated | Hyperlipidaemia | [23] | |
NTE-122 | Drug Info | Terminated | Atherosclerosis | [24] | |
PD-132301-2 | Drug Info | Terminated | Arteriosclerosis | [25] | |
RP-70676 | Drug Info | Terminated | Hyperlipidaemia | [26] | |
RP-73163 | Drug Info | Terminated | Arteriosclerosis | [27] | |
TEI-6522 | Drug Info | Terminated | Arteriosclerosis | [28] | |
Inhibitor | (1R)-1,2,2-TRIMETHYLPROPYL (R)-METHYLPHOSPHINATE | Drug Info | [29] | ||
(E)-Octadec-9-enoic acid phenylamide | Drug Info | [30] | |||
1,1,1-trifluoro-3-(hexylsulfinyl)propan-2-one | Drug Info | [31] | |||
1,1,1-trifluoro-3-(hexylsulfonyl)propan-2-one | Drug Info | [31] | |||
1,1,1-trifluoro-3-(hexylthio)propan-2-one | Drug Info | [31] | |||
1,1,1-trifluoro-3-(octylsulfinyl)propan-2-one | Drug Info | [31] | |||
1,1,1-trifluoro-3-(octylsulfonyl)propan-2-one | Drug Info | [31] | |||
1,1,1-trifluoro-3-(octylthio)propan-2-one | Drug Info | [31] | |||
1,1,1-trifluorododecan-2-one | Drug Info | [31] | |||
1,10-phenanthroline-5,6-dione | Drug Info | [32] | |||
1,2-bis(2,3,4-trifluorophenyl)-2-hydroxyethanone | Drug Info | [33] | |||
1,2-bis(2,3,4-trifluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-bis(2,3,5-trifluorophenyl)-2-hydroxyethanone | Drug Info | [33] | |||
1,2-bis(2,3,5-trifluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-bis(2,3,6-trifluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-bis(2,3-difluorophenyl)-2-hydroxyethanone | Drug Info | [33] | |||
1,2-bis(2,3-fluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-bis(2,4-difluorophenyl)-2-hydroxyethanone | Drug Info | [33] | |||
1,2-bis(2,4-difluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-bis(2,5-difluorophenyl)-2-hydroxyethanone | Drug Info | [33] | |||
1,2-bis(2,5-difluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-bis(2,6-difluorophenyl)-2-hydroxyethanone | Drug Info | [33] | |||
1,2-bis(2,6-difluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-bis(2-fluorophenyl)-2-hydroxyethanone | Drug Info | [33] | |||
1,2-bis(2-fluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-bis(3,4,5-trifluorophenyl)-2-hydroxyethanone | Drug Info | [33] | |||
1,2-bis(3,4,5-trifluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-bis(3,4-difluorophenyl)-2-hydroxyethanone | Drug Info | [33] | |||
1,2-bis(3,4-difluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-bis(3,5-difluorophenyl)-2-hydroxyethanone | Drug Info | [33] | |||
1,2-bis(3,5-difluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-bis(3-fluorophenyl)-2-hydroxyethanon | Drug Info | [33] | |||
1,2-bis(3-fluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-bis(4-fluorophenyl)ethane-1,2-dione | Drug Info | [33] | |||
1,2-Bis-(2-chloro-phenyl)-ethane-1,2-dione | Drug Info | [34] | |||
1,2-Bis-(3-methoxy-phenyl)-ethane-1,2-dione | Drug Info | [34] | |||
1,2-Bis-(3-nitro-phenyl)-ethane-1,2-dione | Drug Info | [34] | |||
1,2-Bis-(4-bromo-phenyl)-ethane-1,2-dione | Drug Info | [34] | |||
1,2-Bis-(4-chloro-phenyl)-ethane-1,2-dione | Drug Info | [34] | |||
1,2-Bis-(4-methoxy-phenyl)-ethane-1,2-dione | Drug Info | [34] | |||
1,2-Di-naphthalen-2-yl-ethane-1,2-dione | Drug Info | [35] | |||
1,2-Di-p-tolyl-ethane-1,2-dione | Drug Info | [34] | |||
1,2-dicyclohexylethane-1,2-dione | Drug Info | [32] | |||
1,2-indanedione | Drug Info | [32] | |||
1,2-NAPHTHOQUINONE | Drug Info | [32] | |||
1-(2-bromoethyl)-1H-indole-2,3-dione | Drug Info | [36] | |||
1-(2-iodoethyl)-1H-indole-2,3-dione | Drug Info | [36] | |||
1-(3,4-dichlorobenzyl)-1H-indole-2,3-dione | Drug Info | [36] | |||
1-(3,4-Dimethyl-phenyl)-2-phenyl-ethane-1,2-dione | Drug Info | [34] | |||
1-(4-Chloro-phenyl)-2-p-tolyl-ethane-1,2-dione | Drug Info | [34] | |||
1-(4-Chloro-phenyl)-2-phenyl-ethane-1,2-dione | Drug Info | [34] | |||
1-(4-chlorobenzyl)-1H-indole-2,3-dione | Drug Info | [36] | |||
1-(4-Methoxy-phenyl)-2-phenyl-ethane-1,2-dione | Drug Info | [34] | |||
1-(4-Nitro-phenyl)-2-phenyl-ethane-1,2-dione | Drug Info | [34] | |||
1-benzyl-1H-indole-2,3-dione | Drug Info | [36] | |||
1-butyryl-1H-indole-2,3-dione | Drug Info | [36] | |||
1-dodecyl-1H-indole-2,3-dione | Drug Info | [36] | |||
1-hexadecyl-1H-indole-2,3-dione | Drug Info | [36] | |||
1-methyl-1H-indole-2,3-dione | Drug Info | [36] | |||
1-phenyl-1H-indole-2,3-dione | Drug Info | [36] | |||
1-Phenyl-2-p-tolyl-ethane-1,2-dione | Drug Info | [34] | |||
1-Phenyl-propane-1,2-dione | Drug Info | [34] | |||
1-propionyl-1H-indole-2,3-dione | Drug Info | [36] | |||
11,12-dihydro-dibenzo[a,e]cyclooctene-5,6-dione | Drug Info | [32] | |||
2,2-Dimethoxy-1,2-diphenyl-ethanone | Drug Info | [34] | |||
2,2-dimethyl-3-methyleneheptadecane | Drug Info | [31] | |||
2-methoxy-3,4-methylenedioxybenzophenone | Drug Info | [37] | |||
3,4,5,6-Tetrachloro-[1,2]benzoquinone | Drug Info | [34] | |||
3,5-Di-tert-butyl-[1,2]benzoquinone | Drug Info | [34] | |||
3-(butylsulfinyl)-1,1,1-trifluoropropan-2-one | Drug Info | [31] | |||
3-(butylthio)-1,1,1-trifluoropropan-2-one | Drug Info | [31] | |||
3-(decylsulfinyl)-1,1,1-trifluoropropan-2-one | Drug Info | [31] | |||
3-(decylsulfonyl)-1,1,1-trifluoropropan-2-one | Drug Info | [31] | |||
3-(decylthio)-1,1,1-trifluoropropan-2-one | Drug Info | [31] | |||
3-(dodecylsulfinyl)-1,1,1-trifluoropropan-2-one | Drug Info | [31] | |||
3-(dodecylsulfonyl)-1,1,1-trifluoropropan-2-one | Drug Info | [31] | |||
4,5-dichloro-1H-indole-2,3-dione | Drug Info | [36] | |||
4,6-dichloro-1H-indole-2,3-dione | Drug Info | [36] | |||
4,7-dichloro-1H-indole-2,3-dione | Drug Info | [36] | |||
4-(2-Oxo-2-phenyl-acetyl)-benzoic acid | Drug Info | [34] | |||
4-chloro-1H-indole-2,3-dione | Drug Info | [36] | |||
4-chloro-7-methyl-1H-indole-2,3-dione | Drug Info | [36] | |||
4-Piperidino-Piperidine | Drug Info | [29] | |||
5,6-dinitroacenaphthoquinone | Drug Info | [32] | |||
5,7-dichloro-1H-indole-2,3-dione | Drug Info | [36] | |||
5-(trifluoromethoxy)-1H-indole-2,3-dione | Drug Info | [36] | |||
5-chloro-1H-indole-2,3-dione | Drug Info | [36] | |||
6,7-dichloro-1H-indole-2,3-dione | Drug Info | [36] | |||
6-bromo-5-methyl-1H-indole-2,3-dione | Drug Info | [36] | |||
7-(trifluoromethyl)-1H-indole-2,3-dione | Drug Info | [36] | |||
7-chloro-1H-indole-2,3-dione | Drug Info | [36] | |||
Acenanthrene-9,10-dione | Drug Info | [32] | |||
ACENAPHTHOQUINONE | Drug Info | [32] | |||
Alpha-D-Mannose | Drug Info | [38] | |||
Avasimibe | Drug Info | [39] | |||
BENZIL | Drug Info | [31] | |||
BENZOIN | Drug Info | [33] | |||
CEB-925 | Drug Info | [40] | |||
CHLORANIL | Drug Info | [34] | |||
Cholic Acid | Drug Info | [38] | |||
CI-976 | Drug Info | [41] | |||
CI-999 | Drug Info | [42] | |||
Dibutyl 2,2,2-trifluoro-1-phenylethyl phosphate | Drug Info | [43] | |||
Diethyl 2,2,2-trifluoro-1-phenylethyl phosphate | Drug Info | [43] | |||
Dimethyl 2,2,2-trifluoro-1-phenylethyl phosphate | Drug Info | [43] | |||
DuP-129 | Drug Info | [44] | |||
Eflucimibe | Drug Info | [45] | |||
GR148672X | Drug Info | [44] | |||
Heptane-2,3-dione | Drug Info | [34] | |||
K-604 | Drug Info | [46] | |||
N-Methylnaloxonium | Drug Info | [47] | |||
NSC-23180 | Drug Info | [32] | |||
NTE-122 | Drug Info | [48] | |||
O-Sialic Acid | Drug Info | [29] | |||
Oleic acid anilide | Drug Info | [37] | |||
PACTIMIBE | Drug Info | [49] | |||
Phenanthrene-9,10-dione | Drug Info | [32] | |||
PYRIPYROPENE A | Drug Info | [30] | |||
SCH-48375 | Drug Info | [50] | |||
Thenoyltrifluoroacetone | Drug Info | [51] | |||
Thieno[3,2-e][1]benzothiophene-4,5-dione | Drug Info | [32] | |||
VULM-1457 | Drug Info | [44] | |||
YM-750 | Drug Info | [52] | |||
Modulator | 447C88 | Drug Info | [53] | ||
CL-277082 | Drug Info | [54] | |||
CL-283796 | Drug Info | [55], [56] | |||
E-5324 | Drug Info | [57] | |||
Eldacimibe | Drug Info | [45] | |||
F-1394 | Drug Info | [58] | |||
FR-129169 | Drug Info | [59] | |||
FR-145237 | Drug Info | [60] | |||
HL-004 | Drug Info | [61] | |||
KY-382 | Drug Info | [44] | |||
Lecimibide | Drug Info | [62] | |||
PD-132301-2 | Drug Info | [63] | |||
RP-64477 | Drug Info | [64] | |||
RP-70676 | Drug Info | [65] | |||
RP-73163 | Drug Info | [66] | |||
SMP-797 | Drug Info | ||||
TEI-6522 | Drug Info | [67] | |||
YM-17E | Drug Info | [68] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Drug metabolism - other enzymes | ||||
Metabolic pathways | |||||
Pathway Interaction Database | E2F transcription factor network | ||||
WikiPathways | NRF2 pathway | ||||
Nuclear Receptors Meta-Pathway | |||||
Heroin metabolism | |||||
Irinotecan Pathway | |||||
Fluoropyrimidine Activity | |||||
Phase I biotransformations, non P450 | |||||
References | |||||
REF 1 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 609). | ||||
REF 2 | ClinicalTrials.gov (NCT00151788) Efficacy and Safety of the ACAT Inhibitor CS-505 (Pactimibe) for Reducing the Progression of Carotid Artery Disease. This Study is Also Known as CAPTIVATE.. U.S. National Institutes of Health. | ||||
REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003592) | ||||
REF 4 | ClinicalTrials.gov (NCT00851500) A Trial of the Safety and Efficacy of K-604 for the Treatment of Atherosclerosis. U.S. National Institutes of Health. | ||||
REF 5 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6701). | ||||
REF 6 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033616) | ||||
REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008778) | ||||
REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001196) | ||||
REF 9 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004604) | ||||
REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004427) | ||||
REF 11 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011031) | ||||
REF 12 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002301) | ||||
REF 13 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002257) | ||||
REF 14 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001648) | ||||
REF 15 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003109) | ||||
REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002618) | ||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003090) | ||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010079) | ||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010990) | ||||
REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003587) | ||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002683) | ||||
REF 22 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006465) | ||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002283) | ||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008195) | ||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002679) | ||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002876) | ||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003588) | ||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004501) | ||||
REF 29 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
REF 30 | Bioorg Med Chem Lett. 2004 Aug 16;14(16):4277-80.Acyl-CoA: cholesterol acyltransferase inhibitory activities of fatty acid amides isolated from Mylabris phalerate Pallas. | ||||
REF 31 | Bioorg Med Chem. 2008 Feb 15;16(4):2114-30. Epub 2007 Nov 26.Influence of sulfur oxidation state and steric bulk upon trifluoromethyl ketone (TFK) binding kinetics to carboxylesterases and fatty acid amide hydrolase (FAAH). | ||||
REF 32 | J Med Chem. 2007 Nov 15;50(23):5727-34. Epub 2007 Oct 17.Planarity and constraint of the carbonyl groups in 1,2-diones are determinants for selective inhibition of human carboxylesterase 1. | ||||
REF 33 | Bioorg Med Chem. 2007 Jun 1;15(11):3801-17. Epub 2007 Mar 12.Analysis of the inhibition of mammalian carboxylesterases by novel fluorobenzoins and fluorobenzils. | ||||
REF 34 | J Med Chem. 2005 Apr 21;48(8):2906-15.Identification and characterization of novel benzil (diphenylethane-1,2-dione) analogues as inhibitors of mammalian carboxylesterases. | ||||
REF 35 | J Med Chem. 2005 Aug 25;48(17):5543-50.Inhibition of carboxylesterases by benzil (diphenylethane-1,2-dione) and heterocyclic analogues is dependent upon the aromaticity of the ring and the flexibility of the dione moiety. | ||||
REF 36 | J Med Chem. 2007 Apr 19;50(8):1876-85. Epub 2007 Mar 23.Selective inhibition of carboxylesterases by isatins, indole-2,3-diones. | ||||
REF 37 | J Nat Prod. 2006 May;69(5):853-5.Phenolic compounds from the roots of Lindera fruticosa. | ||||
REF 38 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 39 | New advances in lipid-modifying therapies for reducing cardiovascular risk. Cardiology. 2002;97(2):59-66. | ||||
REF 40 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010079) | ||||
REF 41 | Acyl-coenzyme A:cholesterol-acyltransferase (ACAT) inhibitors modulate monocyte adhesion to aortic endothelial cells. Atherosclerosis. 1995 Jan 6;112(1):7-17. | ||||
REF 42 | Inhibitors of acyl-CoA:cholesterol O-acyltransferase (ACAT) as hypocholesterolemic agents: synthesis and structure-activity relationships of novel series of sulfonamides, acylphosphonamides and acylphosphoramidates. Bioorg Med Chem Lett. 1998 Feb 3;8(3):289-94. | ||||
REF 43 | Bioorg Med Chem Lett. 2009 Oct 1;19(19):5528-30. Epub 2009 Aug 21.Synthesis of organophosphates with fluorine-containing leaving groups as serine esterase inhibitors with potential for Alzheimer disease therapeutics. | ||||
REF 44 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2592). | ||||
REF 45 | Prospects for drug therapy for hyperlipoproteinaemia. Diabete Metab. 1995 Apr;21(2):139-46. | ||||
REF 46 | A selective ACAT-1 inhibitor, K-604, suppresses fatty streak lesions in fat-fed hamsters without affecting plasma cholesterol levels. Atherosclerosis. 2007 Apr;191(2):290-7. Epub 2006 Jul 3. | ||||
REF 47 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January | ||||
REF 48 | Cholesterol-lowering effects of NTE-122, a novel acyl-CoA:cholesterol acyltransferase (ACAT) inhibitor, on cholesterol diet-fed rats and rabbits. Jpn J Pharmacol. 1998 Nov;78(3):355-64. | ||||
REF 49 | J Med Chem. 2008 Aug 14;51(15):4823-33. Epub 2008 Jul 12.Novel indoline-based acyl-CoA:cholesterol acyltransferase inhibitor with antiperoxidative activity: improvement of physicochemical propertiesand biological activities by introduction of carboxylic acid. | ||||
REF 50 | J Med Chem. 1994 Jun 10;37(12):1733-6.2-Azetidinones as inhibitors of cholesterol absorption. | ||||
REF 51 | Zhang JG, Fariss MW: Thenoyltrifluoroacetone, a potent inhibitor of carboxylesterase activity. Biochem Pharmacol. 2002 Feb 15;63(4):751-4. | ||||
REF 52 | Effects of an anti-oxidative ACAT inhibitor on apoptosis/necrosis and cholesterol accumulation under oxidative stress in THP-1 cell-derived foam cells. Life Sci. 2008 Jan 2;82(1-2):79-84. Epub 2007 Nov 26. | ||||
REF 53 | The tolerability, pharmacokinetics and lack of effect on plasma cholesterol of 447C88, an AcylCoA: Cholesterol Acyl Transferase (ACAT) inhibitor with low bioavailability, in healthy volunteers. Eur JClin Pharmacol. 1995;49(3):243-9. | ||||
REF 54 | CL 277,082: a novel inhibitor of ACAT-catalyzed cholesterol esterification and cholesterol absorption. J Lipid Res. 1989 May;30(5):681-90. | ||||
REF 55 | Therapeutic target database update 2012: a resource for facilitating target-oriented drug discovery. Nucleic Acids Res. 2012 Jan;40(Database issue):D1128-36. | ||||
REF 56 | ACAT inhibitors CL 283,546 and CL 283,796 reduce LDL cholesterol without affecting cholesterol absorption in African green monkeys. J Lipid Res. 1995 Jun;36(6):1199-210. | ||||
REF 57 | Effect of the acyl-CoA:cholesterol acyltransferase inhibitor, E5324, on experimental atherosclerosis in rabbits. Atherosclerosis. 1994 Jun;107(2):187-201. | ||||
REF 58 | ACAT inhibitor F-1394 prevents intimal hyperplasia induced by balloon injury in rabbits. J Lipid Res. 2001 Apr;42(4):480-8. | ||||
REF 59 | Plasma cholesterol reducing effect of FR129169, a novel acyl-CoA:cholesterol acyltransferase inhibitor, in the rat. Jpn J Pharmacol. 1996 Jan;70(1):35-41. | ||||
REF 60 | Effect of FR145237, a novel ACAT inhibitor, on atherogenesis in cholesterol-fed and WHHL rabbits. Evidence for a direct effect on the arterial wall. Biochim Biophys Acta. 1995 Dec 7;1259(3):254-60. | ||||
REF 61 | ACAT inhibitor HL-004 accelerates the regression of hypercholesterolemia in stroke-prone spontaneously hypertensive rats (SHRSP): stimulation of bile acid production by HL-004. Atherosclerosis. 1997 Aug;133(1):97-104. | ||||
REF 62 | Effect of the acyl-CoA:cholesterol acyltransferase inhibitor DuP 128 on cholesterol absorption and serum cholesterol in humans. Clin Pharmacol Ther. 1994 Jul;56(1):65-74. | ||||
REF 63 | Divergent pharmacologic activities of PD 132301-2 and CL 277,082, urea inhibitors of acyl-CoA:cholesterol acyltransferase. J Pharmacol Exp Ther. 1993 Nov;267(2):734-43. | ||||
REF 64 | RP 64477: a potent inhibitor of acyl-coenzyme A:cholesterol O-acyltransferase with low systemic bioavailability. Biochem Pharmacol. 1996 Feb 23;51(4):413-21. | ||||
REF 65 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002876) | ||||
REF 66 | Hypolipidaemic properties of a potent and bioavailable alkylsulphinyl-diphenylimidazole ACAT inhibitor (RP 73163) in animals fed diets low in cholesterol. Biochem Pharmacol. 1996 Oct 25;52(8):1177-86. | ||||
REF 67 | Potent inhibitors of acyl-CoA:cholesterol acyltransferase. Structure-activity relationships of novel N-(4-oxochroman-8-yl)amides. J Med Chem. 1995 Aug 4;38(16):3174-86. | ||||
REF 68 | Pharmacological properties of YM17E, an acyl-CoA:cholesterol acyltransferase inhibitor, and diarrheal effect in beagle dogs. Jpn J Pharmacol. 1997 Jan;73(1):41-50. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.