Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T13714
|
||||
Former ID |
TTDR00421
|
||||
Target Name |
Oxysterols receptor LXR-beta
|
||||
Gene Name |
NR1H2
|
||||
Synonyms |
LXRbeta; Liver X receptor beta; Nuclear orphan receptor LXR-beta; Nuclear receptor NER; Ubiquitously-expressed nuclear receptor; NR1H2
|
||||
Target Type |
Research
|
||||
Disease | Atherosclerosis [ICD9: 414.0, 440; ICD10: I70] | ||||
Function |
Nuclear receptor. Binds preferentially to double- stranded oligonucleotide direct repeats having the consensus half- site sequence 5'-AGGTCA-3' and 4-nt spacing (DR-4). Regulates cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8; DLDLR and LRP8. Interplays functionally with RORA for the regulation of genes involved in liver metabolism (By similarity).
|
||||
BioChemical Class |
Nuclear hormone receptor
|
||||
Target Validation |
T13714
|
||||
UniProt ID | |||||
Sequence |
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE |
||||
Inhibitor | 12,17-dehydroxyriccardin C | Drug Info | [1] | ||
12-dehydroxyriccardin C | Drug Info | [1] | |||
17-dehydroxyriccardin C | Drug Info | [1] | |||
2-Benzyl-3-phenyl-7-(trifluoromethyl)-2H-indazole | Drug Info | [2] | |||
2-benzyl-4,5,6,7-tetrachloroisoindoline-1,3-dione | Drug Info | [3] | |||
2-Propanol, Isopropanol | Drug Info | [4] | |||
4,17-dehydroxyriccardin C | Drug Info | [1] | |||
4-dehydroxyriccardin C | Drug Info | [1] | |||
Benzenesulfonyl | Drug Info | [4] | |||
GSK-9772 | Drug Info | [5] | |||
GW-3965 | Drug Info | [2] | |||
N-{4-[2-(3-Methoxyphenyl)ethyl]phenyl}phthalimide | Drug Info | [6] | |||
Riccardin C | Drug Info | [1] | |||
WAY-214950 | Drug Info | [2] | |||
WAY-252623 | Drug Info | [2] | |||
WAY-254011 | Drug Info | [7] | |||
Agonist | 22R-hydroxycholesterol | Drug Info | [8] | ||
24(S), 25-epoxycholesterol | Drug Info | [9] | |||
24(S)-hydroxycholesterol | Drug Info | [10] | |||
27-hydroxycholesterol | Drug Info | [11] | |||
acetyl-podocarpic dimer | Drug Info | [12] | |||
AZ12260493 | Drug Info | [13] | |||
desmosterol | Drug Info | [14] | |||
L-783483 | Drug Info | [15] | |||
Antagonist | GSK2033 | Drug Info | [16] | ||
SR9238 | Drug Info | [17] | |||
Pathways | |||||
Pathway Interaction Database | RXR and RAR heterodimerization with other nuclear receptor | ||||
Reactome | Nuclear Receptor transcription pathway | ||||
WikiPathways | SREBP signalling | ||||
Nuclear Receptors | |||||
References | |||||
REF 1 | Bioorg Med Chem. 2008 Apr 15;16(8):4272-85. Epub 2008 Feb 29.Co-existence of alpha-glucosidase-inhibitory and liver X receptor-regulatory activities and their separation by structural development. | ||||
REF 2 | J Med Chem. 2008 Nov 27;51(22):7161-8.Indazole-based liver X receptor (LXR) modulators with maintained atherosclerotic lesion reduction activity but diminished stimulation of hepatic triglyceride synthesis. | ||||
REF 3 | Bioorg Med Chem Lett. 2007 Jul 15;17(14):3957-61. Epub 2007 Apr 30.Liver X receptor antagonists with a phthalimide skeleton derived from thalidomide-related glucosidase inhibitors. | ||||
REF 4 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 5 | J Med Chem. 2008 Sep 25;51(18):5758-65.Structure-guided design of N-phenyl tertiary amines as transrepression-selective liver X receptor modulators with anti-inflammatory activity. | ||||
REF 6 | Bioorg Med Chem. 2009 Jul 15;17(14):5001-14. Epub 2009 Jun 2.Separation of alpha-glucosidase-inhibitory and liver X receptor-antagonistic activities of phenethylphenyl phthalimide analogs and generation of LXRalpha-selective antagonists. | ||||
REF 7 | Bioorg Med Chem. 2009 May 15;17(10):3519-27. Epub 2009 Apr 12.Discovery and SAR of cinnolines/quinolines as liver X receptor (LXR) agonists with binding selectivity for LXRbeta. | ||||
REF 8 | An oxysterol signalling pathway mediated by the nuclear receptor LXR alpha. Nature. 1996 Oct 24;383(6602):728-31. | ||||
REF 9 | Brain endogenous liver X receptor ligands selectively promote midbrain neurogenesis. Nat Chem Biol. 2013 Feb;9(2):126-33. | ||||
REF 10 | Activation of the nuclear receptor LXR by oxysterols defines a new hormone response pathway. J Biol Chem. 1997 Feb 7;272(6):3137-40. | ||||
REF 11 | 27-hydroxycholesterol is an endogenous ligand for liver X receptor in cholesterol-loaded cells. J Biol Chem. 2001 Oct 19;276(42):38378-87. Epub 2001 Aug 14. | ||||
REF 12 | A potent synthetic LXR agonist is more effective than cholesterol loading at inducing ABCA1 mRNA and stimulating cholesterol efflux. J Biol Chem. 2002 Mar 22;277(12):10021-7. Epub 2002 Jan 14. | ||||
REF 13 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 601). | ||||
REF 14 | Sterol intermediates from cholesterol biosynthetic pathway as liver X receptor ligands. J Biol Chem. 2006 Sep 22;281(38):27816-26. Epub 2006 Jul 20. | ||||
REF 15 | A novel liver X receptor agonist establishes species differences in the regulation of cholesterol 7alpha-hydroxylase (CYP7a). Endocrinology. 2002 Jul;143(7):2548-58. | ||||
REF 16 | Discovery of tertiary sulfonamides as potent liver X receptor antagonists. J Med Chem. 2010 Apr 22;53(8):3412-6. | ||||
REF 17 | A liver-selective LXR inverse agonist that suppresses hepatic steatosis. ACS Chem Biol. 2013 Mar 15;8(3):559-67. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.