Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T68251
|
||||
Former ID |
TTDC00104
|
||||
Target Name |
72 kDa type IV collagenase
|
||||
Gene Name |
MMP2
|
||||
Synonyms |
72 kDa gelatinase; Gelatinase A; MMP-2; Matrix metalloproteinase 2; Matrix metalloproteinase-2; TBE-1; MMP2
|
||||
Target Type |
Successful
|
||||
Disease | Acne vulgaris [ICD9: 706.1; ICD10: L70.0] | ||||
Brain cancer [ICD9: 191, 225.0; ICD10: C71, D33] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
HCV infection [ICD9: 070.4, 070.5, 070.70; ICD10: B17.1, B18.2] | |||||
Lung cancer; Prostate cancer [ICD9: 140-229, 162, 185; ICD10: C33-C34, C61] | |||||
Multiple scierosis [ICD9: 340; ICD10: G35] | |||||
Non-small-cell lung cancer; Hormone-refractory prostate cancer; Kaposi's sarcoma [ICD9: 140-229, 162, 176, 185, 204.0; ICD10: C33, C33-C34, C34, C46, C61, C91.0] | |||||
Non-small-cell lung cancer; Renal cell carcinoma [ICD9: 140-229, 162, 162.9, 189, 204.0; ICD10: C33, C33-C34, C34, C34.90, C64, C91.0] | |||||
Pancreatic cancer; Lung cancer; Ovarian cancer; Osteoarthritis [ICD9: 140-229, 157, 162, 183, 715; ICD10: C25, C33-C34, C56, M15-M19, M47] | |||||
Pancreatic cancer; Lung cancer [ICD9: 140-229, 157, 162; ICD10: C25, C33-C34] | |||||
Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48] | |||||
Function |
Isoform 2: Mediates the proteolysis of CHUK/IKKA and initiates a primary innate immune response by inducing mitochondrial-nuclear stress signaling with activation of the pro- inflammatory NF-kappaB, NFAT and IRF transcriptional pathways.
|
||||
BioChemical Class |
Peptidase
|
||||
Target Validation |
T68251
|
||||
UniProt ID | |||||
EC Number |
EC 3.4.24.24
|
||||
Sequence |
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC |
||||
Drugs and Mode of Action | |||||
Drug(s) | Prinomastat | Drug Info | Approved | Lung cancer; Prostate cancer | [1], [2] |
Marimastat | Drug Info | Phase 3 | Pancreatic cancer | [3], [4] | |
Metastat | Drug Info | Phase 1 | Acne vulgaris | [5], [6] | |
Neovastat | Drug Info | Phase 1 | Non-small-cell lung cancer; Renal cell carcinoma | [7] | |
ILOMASTAT | Drug Info | Preclinical | Discovery agent | [8], [9] | |
RO-26-2853 | Drug Info | Preclinical | Cancer | [10] | |
BMS 275291 | Drug Info | Discontinued in Phase 3 | Non-small-cell lung cancer; Hormone-refractory prostate cancer; Kaposi's sarcoma | [11] | |
Marimastat | Drug Info | Discontinued in Phase 3 | Pancreatic cancer; Lung cancer | [3], [12] | |
Prinomastat | Drug Info | Discontinued in Phase 3 | Brain cancer | [1], [2] | |
Tanomastat | Drug Info | Discontinued in Phase 3 | Pancreatic cancer; Lung cancer; Ovarian cancer; Osteoarthritis | [13], [14] | |
Galarubicin | Drug Info | Discontinued in Phase 2 | Solid tumours | [15] | |
RS-130830 | Drug Info | Discontinued in Phase 2 | HCV infection | [16] | |
BB-1101 | Drug Info | Terminated | Multiple scierosis | [17] | |
BB-3644 | Drug Info | Terminated | Cancer | [18] | |
CDP-845 | Drug Info | Terminated | Cancer | [19] | |
L-696418 | Drug Info | Terminated | Discovery agent | [20] | |
SC-44463 | Drug Info | Terminated | Discovery agent | [21] | |
Inhibitor | (+/-)5-(biphenyl-4-yl)-3-hydroxypentanoic acid | Drug Info | [22] | ||
2-(4'-chloro-biphenyl-4-sulfonyl)-pentanoic acid | Drug Info | [23] | |||
2-(Biphenyl-4-ylsulfonyl)N-hydroxybenzamide | Drug Info | [24] | |||
3-(4-(2-phenylethynyl)benzoyl)pentanoic acid | Drug Info | [25] | |||
3-(4-Phenylethynylbenzoyl)nonanoic acid | Drug Info | [25] | |||
4-(4-(dec-1-ynyl)phenyl)-4-oxobutanoic acid | Drug Info | [25] | |||
5-(4-Phenoxy-phenyl)-pyrimidine-2,4,6-trione | Drug Info | [26] | |||
5-Biphenyl-4-yl-5-ethyl-pyrimidine-2,4,6-trione | Drug Info | [26] | |||
5-Biphenyl-4-yl-5-hexyl-pyrimidine-2,4,6-trione | Drug Info | [26] | |||
5-Hexyl-5-phenyl-pyrimidine-2,4,6-trione | Drug Info | [26] | |||
BB-1101 | Drug Info | [27] | |||
BB-3644 | Drug Info | [28], [18] | |||
BMS 275291 | Drug Info | [28], [29], [30], [11] | |||
Cis-2-aminocyclohexylcarbamoylphosphonic acid | Drug Info | [31] | |||
Clinopodic acid C | Drug Info | [32] | |||
EPIGALOCATECHIN GALLATE | Drug Info | [33] | |||
Folate gamma-hydroxamic acid | Drug Info | [34] | |||
Folate gamma-L-proline-hydroxamic acid | Drug Info | [34] | |||
Galarubicin | Drug Info | [35] | |||
IK-682 | Drug Info | [36] | |||
ILOMASTAT | Drug Info | [37] | |||
L-696418 | Drug Info | [38] | |||
Lithospermic acid | Drug Info | [32] | |||
Marimastat | Drug Info | [28], [39], [40], [41] | |||
Metastat | Drug Info | [42] | |||
Methotrexate gamma-hydroxamic acid | Drug Info | [34] | |||
Methotrexate gamma-L-proline-hydroxamic acid | Drug Info | [34] | |||
MMI270 | Drug Info | [43] | |||
N-Hydroxy-2-(4-phenoxy-benzenesulfonyl)benzamide | Drug Info | [24] | |||
N-hydroxy-3-(2-oxo-2H-chromen-3-yl)propanamide | Drug Info | [44] | |||
N-hydroxy-3-(6-methoxy-2-oxo-2H-chromen-3-yl) | Drug Info | [44] | |||
Neovastat | Drug Info | [45], [46], [47] | |||
PD-169469 | Drug Info | [48] | |||
PNU-107859 | Drug Info | [49] | |||
Prinomastat | Drug Info | [28], [50], [51], [52], [53] | |||
RO-26-2853 | Drug Info | [10] | |||
Ro-37-9790 | Drug Info | [54] | |||
Roche 28-2653 | Drug Info | [55] | |||
RS-130830 | Drug Info | [56] | |||
SC-44463 | Drug Info | [57] | |||
SC-74020 | Drug Info | [58] | |||
SR-973 | Drug Info | [59] | |||
Tanomastat | Drug Info | [28], [60], [61], [62] | |||
UK-356618 | Drug Info | [57] | |||
[2-(Biphenyl-4-sulfonyl)phenyl]acetic Acid | Drug Info | [24] | |||
Modulator | CDP-845 | Drug Info | [63] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Leukocyte transendothelial migration | ||||
GnRH signaling pathway | |||||
Estrogen signaling pathway | |||||
Pathways in cancer | |||||
Proteoglycans in cancer | |||||
Bladder cancer | |||||
NetPath Pathway | Leptin Signaling Pathway | ||||
TCR Signaling Pathway | |||||
ID Signaling Pathway | |||||
PANTHER Pathway | Alzheimer disease-presenilin pathway | ||||
Pathway Interaction Database | LPA receptor mediated events | ||||
Plasma membrane estrogen receptor signaling | |||||
Osteopontin-mediated events | |||||
Validated transcriptional targets of AP1 family members Fra1 and Fra2 | |||||
Angiopoietin receptor Tie2-mediated signaling | |||||
Direct p53 effectors | |||||
amb2 Integrin signaling | |||||
ATF-2 transcription factor network | |||||
FOXM1 transcription factor network | |||||
Regulation of nuclear beta catenin signaling and target gene transcription | |||||
Syndecan-2-mediated signaling events | |||||
Reactome | Collagen degradation | ||||
Degradation of the extracellular matrix | |||||
Activation of Matrix Metalloproteinases | |||||
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) | |||||
EPH-ephrin mediated repulsion of cells | |||||
WikiPathways | Activation of Matrix Metalloproteinases | ||||
AGE/RAGE pathway | |||||
Matrix Metalloproteinases | |||||
References | |||||
REF 1 | Emerging therapies for neuropathic pain. Expert Opin Emerg Drugs. 2005 Feb;10(1):95-108. | ||||
REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6505). | ||||
REF 3 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5220). | ||||
REF 4 | Randomized phase III trial of marimastat versus placebo in patients with metastatic breast cancer who have responding or stable disease after first-line chemotherapy: Eastern Cooperative Oncology Group trial E2196. J Clin Oncol. 2004 Dec 1;22(23):4683-90. | ||||
REF 5 | ClinicalTrials.gov (NCT00001683) A Phase I Study of Oral COL-3 (NSC-683551), a Matrix Metalloproteinase Inhibitor, in Patients With Refractory Metastatic Cancer. U.S. National Institutes of Health. | ||||
REF 6 | A phase I and pharmacokinetic study of Col-3 (Metastat), an oral tetracycline derivative with potent matrix metalloproteinase and antitumor properties. Clin Cancer Res. 2004 Oct 1;10(19):6512-21. | ||||
REF 7 | Emerging therapies for multiple myeloma. Expert Opin Emerg Drugs. 2009 Mar;14(1):99-127. | ||||
REF 8 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7409). | ||||
REF 9 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001387) | ||||
REF 10 | Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52. | ||||
REF 11 | Phase 1/2 trial of BMS-275291 in patients with human immunodeficiency virus-related Kaposi sarcoma: a multicenter trial of the AIDS Malignancy Consortium. Cancer. 2008 Mar 1;112(5):1083-8. | ||||
REF 12 | Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91. | ||||
REF 13 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6468). | ||||
REF 14 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010243) | ||||
REF 15 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004410) | ||||
REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010620) | ||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006361) | ||||
REF 18 | A phase I and pharmacological study of the matrix metalloproteinase inhibitor BB-3644 in patients with solid tumours. Br J Cancer. 2004 Feb 23;90(4):800-4. | ||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006498) | ||||
REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006282) | ||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007717) | ||||
REF 22 | Bioorg Med Chem Lett. 2009 Oct 1;19(19):5760-3. Epub 2009 Aug 6.The identification of beta-hydroxy carboxylic acids as selective MMP-12 inhibitors. | ||||
REF 23 | Bioorg Med Chem Lett. 2006 Jun 15;16(12):3096-100. Epub 2006 May 2.Synthesis and SAR of alpha-sulfonylcarboxylic acids as potent matrix metalloproteinase inhibitors. | ||||
REF 24 | J Med Chem. 2009 Oct 22;52(20):6347-61.Design, synthesis, biological evaluation, and NMR studies of a new series of arylsulfones as selective and potent matrix metalloproteinase-12 inhibitors. | ||||
REF 25 | J Med Chem. 2006 Jan 26;49(2):456-8.Selective inhibition of matrix metalloproteinase isozymes and in vivo protection against emphysema by substituted gamma-keto carboxylic acids. | ||||
REF 26 | Bioorg Med Chem Lett. 2001 Apr 23;11(8):969-72.Novel 5,5-disubstitutedpyrimidine-2,4,6-triones as selective MMP inhibitors. | ||||
REF 27 | Bioorg Med Chem Lett. 1998 Jun 16;8(12):1443-8.Broad spectrum matrix metalloproteinase inhibitors: an examination of succinamide hydroxamate inhibitors with P1 C alpha gem-disubstitution. | ||||
REF 28 | Tumour microenvironment - opinion: validating matrix metalloproteinases as drug targets and anti-targets for cancer therapy. Nat Rev Cancer. 2006 Mar;6(3):227-39. | ||||
REF 29 | Randomized phase II feasibility study of combining the matrix metalloproteinase inhibitor BMS-275291 with paclitaxel plus carboplatin in advanced non-small cell lung cancer. Lung Cancer. 2004 Dec;46(3):361-8. | ||||
REF 30 | Randomized phase III study of matrix metalloproteinase inhibitor BMS-275291 in combination with paclitaxel and carboplatin in advanced non-small-cell lung cancer: National Cancer Institute of Canada-Clinical Trials Group Study BR.18. J Clin Oncol. 2005 Apr 20;23(12):2831-9. | ||||
REF 31 | J Med Chem. 2008 Mar 13;51(5):1406-14. Epub 2008 Feb 8.Carbamoylphosphonate matrix metalloproteinase inhibitors 6: cis-2-aminocyclohexylcarbamoylphosphonic acid, a novel orally active antimetastaticmatrix metalloproteinase-2 selective inhibitor--synthesis and pharmacodynamic and pharmacokinetic analysis. | ||||
REF 32 | J Nat Prod. 2009 Aug;72(8):1379-84.Matrix metalloproteinase-2 inhibitors from Clinopodium chinense var. parviflorum. | ||||
REF 33 | Bioorg Med Chem Lett. 2009 Aug 1;19(15):4171-4. Epub 2009 Jun 2.Regioselective synthesis of methylated epigallocatechin gallate via nitrobenzenesulfonyl (Ns) protecting group. | ||||
REF 34 | Bioorg Med Chem. 2007 Feb 1;15(3):1266-74. Epub 2006 Nov 14.Methotrexate gamma-hydroxamate derivatives as potential dual target antitumor drugs. | ||||
REF 35 | Inhibitory effect of DA-125, a new anthracyclin analog antitumor agent, on the invasion of human fibrosarcoma cells by down-regulating the matrix metalloproteinases. Biochem Pharmacol. 2005 Dec 19;71(1-2):21-31. Epub 2005 Nov 2. | ||||
REF 36 | J Med Chem. 2002 Nov 7;45(23):4954-7.Discovery of gamma-lactam hydroxamic acids as selective inhibitors of tumor necrosis factor alpha converting enzyme: design, synthesis, and structure-activity relationships. | ||||
REF 37 | Bioorg Med Chem. 2008 Sep 15;16(18):8745-59. Epub 2008 Jul 20.Introduction of the 4-(4-bromophenyl)benzenesulfonyl group to hydrazide analogs of Ilomastat leads to potent gelatinase B (MMP-9) inhibitors with improved selectivity. | ||||
REF 38 | Inhibition of matrix metalloproteinases by N-carboxyalkyl peptides containing extended alkyl residues At P1', Bioorg. Med. Chem. Lett. 5(6):539-542 (1995). | ||||
REF 39 | Metalloelastase (MMP-12) induced inflammatory response in mice airways: effects of dexamethasone, rolipram and marimastat. Eur J Pharmacol. 2007 Mar 15;559(1):75-81. Epub 2006 Dec 12. | ||||
REF 40 | Matrix metalloproteinase-2 involvement in breast cancer progression: a mini-review. Med Sci Monit. 2009 Feb;15(2):RA32-40. | ||||
REF 41 | Matrix metalloproteinase inhibition as a novel anticancer strategy: a review with special focus on batimastat and marimastat. Pharmacol Ther. 1997;75(1):69-75. | ||||
REF 42 | Strategies for MMP inhibition in cancer: innovations for the post-trial era. Nat Rev Cancer. 2002 Sep;2(9):657-72. | ||||
REF 43 | Bioorg Med Chem Lett. 1999 Jun 21;9(12):1691-6.Picking the S1, S1' and S2' pockets of matrix metalloproteinases. A niche for potent acyclic sulfonamide inhibitors. | ||||
REF 44 | Bioorg Med Chem. 2008 Jan 1;16(1):530-5. Epub 2007 Sep 14.Chromen-based TNF-alpha converting enzyme (TACE) inhibitors: design, synthesis, and biological evaluation. | ||||
REF 45 | Neovastat, a naturally occurring multifunctional antiangiogenic drug, in phase III clinical trials. Semin Oncol. 2001 Dec;28(6):620-5. | ||||
REF 46 | The effect of Neovastat (AE-941) on an experimental metastatic bone tumor model. Int J Oncol. 2002 Feb;20(2):299-303. | ||||
REF 47 | Neovastat (AE-941) inhibits the airway inflammation and hyperresponsiveness in a murine model of asthma. J Microbiol. 2005 Feb;43(1):11-6. | ||||
REF 48 | J Med Chem. 2006 Feb 9;49(3):923-31.Structural insight into the stereoselective inhibition of MMP-8 by enantiomeric sulfonamide phosphonates. | ||||
REF 49 | J Med Chem. 2004 Jun 3;47(12):3065-74.A molecular basis for the selectivity of thiadiazole urea inhibitors with stromelysin-1 and gelatinase-A from generalized born molecular dynamics simulations. | ||||
REF 50 | AG-3340 (Agouron Pharmaceuticals Inc). IDrugs. 2000 Mar;3(3):336-45. | ||||
REF 51 | Pharmacoproteomics of a metalloproteinase hydroxamate inhibitor in breast cancer cells: dynamics of membrane type 1 matrix metalloproteinase-mediated membrane protein shedding. Mol Cell Biol. 2008 Aug;28(15):4896-914. Epub 2008 May 27. | ||||
REF 52 | Delayed administration of a matrix metalloproteinase inhibitor limits progressive brain injury after hypoxia-ischemia in the neonatal rat. J Neuroinflammation. 2008 Aug 11;5:34. | ||||
REF 53 | Inhibition of gelatinase activity reduces neural injury in an ex vivo model of hypoxia-ischemia. Neuroscience. 2009 Jun 2;160(4):755-66. Epub 2009 Mar 9. | ||||
REF 54 | 11,21-Bisphenyl-19-norpregnane derivatives are selective antiglucocorticoids, Bioorg. Med. Chem. Lett. 7(17):2299-2302 (1997). | ||||
REF 55 | The new synthetic matrix metalloproteinase inhibitor (Roche 28-2653) reduces tumor growth and prolongs survival in a prostate cancer standard rat model. Oncogene. 2002 Mar 27;21(13):2089-96. | ||||
REF 56 | Bioorg Med Chem Lett. 2005 Feb 15;15(4):1101-6.Structure-based design of potent and selective inhibitors of collagenase-3 (MMP-13). | ||||
REF 57 | J Med Chem. 2003 Jul 31;46(16):3514-25.A potent, selective inhibitor of matrix metalloproteinase-3 for the topical treatment of chronic dermal ulcers. | ||||
REF 58 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 59 | Bioorg Med Chem Lett. 2006 May 1;16(9):2357-63. Epub 2006 Feb 10.Synthesis and evaluation of succinoyl-caprolactam gamma-secretase inhibitors. | ||||
REF 60 | A phase III randomized trial of BAY 12-9566 (tanomastat) as maintenance therapy in patients with advanced ovarian cancer responsive to primary surgery and paclitaxel/platinum containing chemotherapy:a National Cancer Institute of Canada Clinical Trials Group Study. Gynecol Oncol. 2006 Aug;102(2):300-8. Epub 2006 Jan 25. | ||||
REF 61 | Conflicting results from clinical observations and murine models: what is the role of plasminogen activators in tumor growth? J Natl Cancer Inst. 2006 Jun 7;98(11):726-7. | ||||
REF 62 | Radiation therapy and biological compounds for consolidation therapy in advanced ovarian cancer. Int J Gynecol Cancer. 2008 Mar-Apr;18 Suppl 1:44-6. | ||||
REF 63 | Clinical potential of matrix metalloprotease inhibitors. Drugs R D. 1999 Feb;1(2):117-29. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.