Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T99347
(Former ID: TTDC00100)
|
|||||
Target Name |
Metabotropic glutamate receptor 5 (mGluR5)
|
|||||
Synonyms |
MGLUR5; GPRC1E
Click to Show/Hide
|
|||||
Gene Name |
GRM5
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Fragile X chromosome [ICD-11: LD55] | |||||
2 | Parkinsonism [ICD-11: 8A00] | |||||
Function |
G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling activates a phosphatidylinositol-calcium second messenger system and generates a calcium-activated chloride current. Plays an important role in the regulation of synaptic plasticity and the modulation of the neural network activity.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR glutamate
|
|||||
UniProt ID | ||||||
Sequence |
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ HRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFD YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG LGAGAGAGGSAGGVGATGGAGCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPS PISTLSHRAGSASRTDDDVPSLHSEPVARSSSSQGSLMEQISSVVTRFTANISELNSMML STAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAA RESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL IIRDYTQSSSSL Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T64P00 |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 11 Clinical Trial Drugs | + | ||||
1 | ADX-48621 | Drug Info | Phase 2/3 | Parkinson disease | [2] | |
2 | AFQ056 | Drug Info | Phase 2/3 | Fragile X syndrome | [3], [4] | |
3 | ADX10059 | Drug Info | Phase 2 | Anxiety disorder | [5] | |
4 | RG-7090 | Drug Info | Phase 2 | Fragile X syndrome | [6] | |
5 | STX-107 | Drug Info | Phase 2 | Autism spectrum disorder | [7], [8] | |
6 | McN3377 | Drug Info | Phase 1/2 | Fragile X syndrome | [9], [10] | |
7 | BMS-984923 | Drug Info | Phase 1 | Alzheimer disease | [11] | |
8 | BMS-984923 | Drug Info | Phase 1 | Alzheimer disease | [12] | |
9 | MK-3328 | Drug Info | Phase 1 | Alzheimer disease | [13] | |
10 | RG7342 | Drug Info | Phase 1 | Schizophrenia | [14] | |
11 | [3H]fenobam | Drug Info | Phase 1 | Allodynia | [15] | |
Patented Agent(s) | [+] 5 Patented Agents | + | ||||
1 | Diazepinone derivative 1 | Drug Info | Patented | Reflux disease | [16] | |
2 | Diazepinone derivative 2 | Drug Info | Patented | Reflux disease | [16] | |
3 | Diazepinone derivative 3 | Drug Info | Patented | Reflux disease | [16] | |
4 | Diazepinone derivative 4 | Drug Info | Patented | Reflux disease | [16] | |
5 | Diazepinone derivative 5 | Drug Info | Patented | Reflux disease | [16] | |
Discontinued Drug(s) | [+] 4 Discontinued Drugs | + | ||||
1 | AZD2066 | Drug Info | Discontinued in Phase 2 | Chronic neuropathic pain | [17] | |
2 | AZD2516 | Drug Info | Discontinued in Phase 2 | Chronic neuropathic pain | [18] | |
3 | LY467711 | Drug Info | Terminated | Migraine | [19] | |
4 | LY525327 | Drug Info | Terminated | Migraine | [19] | |
Mode of Action | [+] 5 Modes of Action | + | ||||
Modulator | [+] 67 Modulator drugs | + | ||||
1 | ADX-48621 | Drug Info | [20] | |||
2 | AFQ056 | Drug Info | [1] | |||
3 | ADX10059 | Drug Info | [21], [22] | |||
4 | McN3377 | Drug Info | [26] | |||
5 | BMS-984923 | Drug Info | [27] | |||
6 | BMS-984923 | Drug Info | [27] | |||
7 | MK-3328 | Drug Info | [28] | |||
8 | 6-aryl-imidazopyridine and 6-aryl-triazolopyridine carboxamide analog 1 | Drug Info | [16] | |||
9 | 6-aryl-imidazopyridine and 6-aryl-triazolopyridine carboxamide analog 2 | Drug Info | [16] | |||
10 | 6-aryl-imidazopyridine and 6-aryl-triazolopyridine carboxamide analog 3 | Drug Info | [16] | |||
11 | Bicarboxylic and tricarboxylic ethynyl derivative 1 | Drug Info | [16] | |||
12 | Bicarboxylic and tricarboxylic ethynyl derivative 2 | Drug Info | [16] | |||
13 | Bicarboxylic and tricarboxylic ethynyl derivative 3 | Drug Info | [16] | |||
14 | Bicyclic heteroaryl carboxamide analog 1 | Drug Info | [16] | |||
15 | Bicyclic heteroaryl carboxamide analog 2 | Drug Info | [16] | |||
16 | Bicyclic heteroaryl carboxamide analog 3 | Drug Info | [16] | |||
17 | Diazepinone derivative 1 | Drug Info | [16] | |||
18 | Diazepinone derivative 2 | Drug Info | [16] | |||
19 | Diazepinone derivative 3 | Drug Info | [16] | |||
20 | Diazepinone derivative 4 | Drug Info | [16] | |||
21 | Diazepinone derivative 5 | Drug Info | [16] | |||
22 | Ethynyl compound 1 | Drug Info | [16] | |||
23 | Ethynyl compound 2 | Drug Info | [16] | |||
24 | Ethynyl compound 3 | Drug Info | [16] | |||
25 | Ethynyl compound 4 | Drug Info | [16] | |||
26 | Ethynyl compound 5 | Drug Info | [16] | |||
27 | Ethynyl compound 6 | Drug Info | [16] | |||
28 | Ethynyl compound 7 | Drug Info | [16] | |||
29 | Heterocyclic derivative 1 | Drug Info | [16] | |||
30 | Heterocyclic derivative 2 | Drug Info | [16] | |||
31 | Heterocyclic derivative 3 | Drug Info | [16] | |||
32 | Imidazopyridine and triazolopyridine compound 1 | Drug Info | [16] | |||
33 | Imidazopyridine and triazolopyridine compound 2 | Drug Info | [16] | |||
34 | Imidazopyridine and triazolopyridine compound 3 | Drug Info | [16] | |||
35 | Imidazopyridine and triazolopyridine compound 4 | Drug Info | [16] | |||
36 | Imidazo[1,2-a]pyridine derivative 1 | Drug Info | [16] | |||
37 | N-alkylamide derivative 1 | Drug Info | [16] | |||
38 | N-alkylamide derivative 2 | Drug Info | [16] | |||
39 | PMID28067079-Compound-95 | Drug Info | [16] | |||
40 | PMID28067079-Compound-97 | Drug Info | [16] | |||
41 | PMID28067079-Compound-98 | Drug Info | [16] | |||
42 | Pyrazolopyrimidine derivative 1 | Drug Info | [16] | |||
43 | Pyrazolopyrimidine derivative 2 | Drug Info | [16] | |||
44 | Pyrazolopyrimidine derivative 3 | Drug Info | [16] | |||
45 | Pyrazolopyrimidine derivative 4 | Drug Info | [16] | |||
46 | Pyrazolopyrimidine derivative 5 | Drug Info | [16] | |||
47 | Pyrazolopyrimidine derivative 6 | Drug Info | [16] | |||
48 | Pyridine derivative 12 | Drug Info | [16] | |||
49 | Pyridine derivative 13 | Drug Info | [16] | |||
50 | Pyridine derivative 14 | Drug Info | [16] | |||
51 | Pyridine derivative 15 | Drug Info | [16] | |||
52 | Pyridine derivative 16 | Drug Info | [16] | |||
53 | Pyridine derivative 17 | Drug Info | [16] | |||
54 | Tetra-hydro-oxazolopyridine derivative 1 | Drug Info | [16] | |||
55 | Tetra-hydro-oxazolopyridine derivative 2 | Drug Info | [16] | |||
56 | Tetra-hydro-oxazolopyridine derivative 3 | Drug Info | [16] | |||
57 | Tetra-hydro-oxazolopyridine derivative 4 | Drug Info | [16] | |||
58 | Tetra-hydro-oxazolopyridine derivative 5 | Drug Info | [16] | |||
59 | Tetra-hydro-oxazolopyridine derivative 6 | Drug Info | [16] | |||
60 | Tetra-hydro-pyrazolopyrazine derivative 1 | Drug Info | [16] | |||
61 | Tetra-hydro-pyrazolopyrazine derivative 2 | Drug Info | [16] | |||
62 | Tetra-hydro-pyrazolopyrazine derivative 3 | Drug Info | [16] | |||
63 | Tetra-hydro-pyrazolopyrazine derivative 4 | Drug Info | [16] | |||
64 | Tetra-hydro-pyrazolopyrazine derivative 5 | Drug Info | [16] | |||
65 | ADX-63365 | Drug Info | [28] | |||
66 | GRN-529 | Drug Info | [28] | |||
67 | LY-3390334 | Drug Info | [71] | |||
Antagonist | [+] 17 Antagonist drugs | + | ||||
1 | RG-7090 | Drug Info | [23] | |||
2 | STX-107 | Drug Info | [24], [25] | |||
3 | 2-(substituted ethynyl)quinoline derivative 1 | Drug Info | [16] | |||
4 | 2-(substituted ethynyl)quinoline derivative 2 | Drug Info | [16] | |||
5 | 2-(substituted ethynyl)quinoline derivative 3 | Drug Info | [16] | |||
6 | 2-(substituted ethynyl)quinoline derivative 4 | Drug Info | [16] | |||
7 | AZD2066 | Drug Info | [31] | |||
8 | AZD2516 | Drug Info | [31] | |||
9 | LY467711 | Drug Info | [26] | |||
10 | LY525327 | Drug Info | [26] | |||
11 | (+)-MCPG | Drug Info | [32] | |||
12 | (S)-4C3HPG | Drug Info | [32] | |||
13 | (S)-4CPG | Drug Info | [32] | |||
14 | ACDPP | Drug Info | [65] | |||
15 | CTEP | Drug Info | [28], [69] | |||
16 | GSK-2210875 | Drug Info | [28] | |||
17 | RTI-4229-982 | Drug Info | [28] | |||
Agonist | [+] 8 Agonist drugs | + | ||||
1 | RG7342 | Drug Info | [29] | |||
2 | (1S,3R)-ACPD | Drug Info | [32] | |||
3 | (S)-(+)-CBPG | Drug Info | [37] | |||
4 | (S)-3HPG | Drug Info | [32] | |||
5 | 3,5-DHPG | Drug Info | [32] | |||
6 | CHPG | Drug Info | [32] | |||
7 | ibotenate | Drug Info | [32] | |||
8 | L-CCG-I | Drug Info | [32] | |||
Modulator (allosteric modulator) | [+] 51 Modulator (allosteric modulator) drugs | + | ||||
1 | [3H]fenobam | Drug Info | [30] | |||
2 | 3,3'-difluorobenzaldazine | Drug Info | [52] | |||
3 | 5-MPEP | Drug Info | [62] | |||
4 | 5PAM523 | Drug Info | [63] | |||
5 | alloswitch-1 | Drug Info | [66] | |||
6 | BOMA | Drug Info | [60] | |||
7 | Br-5MPEPy | Drug Info | [62] | |||
8 | CPPHA | Drug Info | [67] | |||
9 | CPPZ | Drug Info | [68] | |||
10 | LSN2463359 | Drug Info | [70] | |||
11 | LSN2814617 | Drug Info | [70] | |||
12 | M-5MPEP | Drug Info | [62] | |||
13 | NCFP | Drug Info | [74] | |||
14 | PMID14697765C11a | Drug Info | [60] | |||
15 | PMID14697765C16a | Drug Info | [60] | |||
16 | PMID15482906C10 | Drug Info | [75] | |||
17 | PMID15482908C8 | Drug Info | [76] | |||
18 | PMID15686941C13 | Drug Info | [65] | |||
19 | PMID16439120C20 | Drug Info | [42] | |||
20 | PMID16439120C26 | Drug Info | [42] | |||
21 | PMID17189691C42 | Drug Info | [77] | |||
22 | PMID17723296C18 | Drug Info | [40] | |||
23 | PMID17936624C36 | Drug Info | [39] | |||
24 | PMID19931453C16m | Drug Info | [64] | |||
25 | PMID20598884C8 | Drug Info | [57] | |||
26 | PMID20809633C29b | Drug Info | [78] | |||
27 | PMID21295468C47 | Drug Info | [79] | |||
28 | PMID21757343C30 | Drug Info | [80] | |||
29 | PMID21927650C18 | Drug Info | [81] | |||
30 | PMID23357634C24d | Drug Info | [82] | |||
31 | PMID23374867C24 | Drug Info | [83] | |||
32 | PMID23434029C41 | Drug Info | [84] | |||
33 | PMID23434029C53 | Drug Info | [84] | |||
34 | PTeB | Drug Info | [53] | |||
35 | SP203 | Drug Info | [85] | |||
36 | VU-1545 | Drug Info | [59] | |||
37 | VU0092273 | Drug Info | [86] | |||
38 | VU0240382 | Drug Info | [86] | |||
39 | VU0285683 | Drug Info | [87] | |||
40 | VU0357121 | Drug Info | [88] | |||
41 | VU0360172 | Drug Info | [87] | |||
42 | VU0361747 | Drug Info | [86] | |||
43 | VU0364289 | Drug Info | [89] | |||
44 | VU0366058 | Drug Info | [90] | |||
45 | VU0404251 | Drug Info | [91] | |||
46 | VU0424465 | Drug Info | [92] | |||
47 | VU0463841 | Drug Info | [93] | |||
48 | [14C]MTEP | Drug Info | [94] | |||
49 | [3H]methoxy-PEPy | Drug Info | [95] | |||
50 | [3H]methoxymethyl-MTEP | Drug Info | [94], [95] | |||
51 | [3H]resolvin E1 | Drug Info | [33] | |||
Inhibitor | [+] 197 Inhibitor drugs | + | ||||
1 | (3-(2-methylquinolin-7-yl)phenyl)methanol | Drug Info | [33] | |||
2 | (3-Ethoxy-pyridin-2-yl)-pyridin-2-yl-amine | Drug Info | [34] | |||
3 | (E)-1-Adamantan-1-yl-3-quinolin-3-yl-propenone | Drug Info | [35] | |||
4 | (E)-3-[2-(2-methyl-4-thiazolyl)vinyl]pyridine | Drug Info | [36] | |||
5 | 1-(3-(2-methylquinolin-7-yl)phenyl)ethanone | Drug Info | [33] | |||
6 | 2-(2-Methyl-thiazol-4-ylethynyl)-pyridine | Drug Info | [38] | |||
7 | 2-(2-methylquinolin-7-yl)benzonitrile | Drug Info | [33] | |||
8 | 2-(3,4-dimethylphenyl)-1,8-naphthyridine | Drug Info | [39] | |||
9 | 2-(3,5-dichlorophenyl)pyrido[2,3-d]pyrimidine | Drug Info | [40] | |||
10 | 2-(3,5-difluorophenyl)-7-methyl-1,8-naphthyridine | Drug Info | [39] | |||
11 | 2-(3,5-dimethoxyphenyl)-1,8-naphthyridine | Drug Info | [39] | |||
12 | 2-(3-(2-methylquinolin-7-yl)phenyl)acetonitrile | Drug Info | [33] | |||
13 | 2-(3-(3-methoxyphenoxy)prop-1-ynyl)pyridine | Drug Info | [41] | |||
14 | 2-(3-(benzyloxy)phenyl)isoindoline-1,3-dione | Drug Info | [42] | |||
15 | 2-(3-bromophenyl)-7-methyl-1,8-naphthyridine | Drug Info | [39] | |||
16 | 2-(3-bromophenyl)-7-methylpyrido[2,3-d]pyrimidine | Drug Info | [40] | |||
17 | 2-(3-bromophenyl)pyrido[2,3-d]pyrimidine | Drug Info | [40] | |||
18 | 2-(3-chlorobenzyloxy)-6-chloroisonicotinonitrile | Drug Info | [42] | |||
19 | 2-(3-chlorophenyl)-7-methyl-1,8-naphthyridine | Drug Info | [39] | |||
20 | 2-(4-(3-chlorophenyl)but-1-ynyl)-6-methylpyridine | Drug Info | [43] | |||
21 | 2-(m-tolylethynyl)pyrimidine | Drug Info | [44] | |||
22 | 2-(phenylethynyl)pyrimidine | Drug Info | [44] | |||
23 | 2-(pyridin-2-yl)-4-(m-tolylthio)pyrimidine | Drug Info | [45] | |||
24 | 2-Benzoxy-5-(2-methylquinolin-7-yl)benzonitrile | Drug Info | [25] | |||
25 | 2-benzyloxy-7,8-dihydro-6H-quinolin-5-one | Drug Info | [46] | |||
26 | 2-bromo-4-(3-fluorophenylethynyl)thiazole | Drug Info | [36] | |||
27 | 2-Chloro-5-(2-methylquinolin-7-yl)nicotinonitrile | Drug Info | [25] | |||
28 | 2-chloro-N-(3-(3-chlorobenzamido)phenyl)benzamide | Drug Info | [47] | |||
29 | 2-Cyclohex-1-enylethynyl-pyridine | Drug Info | [48] | |||
30 | 2-Cyclohexylethynyl-pyridine | Drug Info | [48] | |||
31 | 2-Cyclopent-1-enylethynyl-pyridine | Drug Info | [48] | |||
32 | 2-ethoxy-5-(m-tolylethynyl)pyrimidine | Drug Info | [44] | |||
33 | 2-ethynyl-4-(3-fluorophenylethynyl)thiazole | Drug Info | [36] | |||
34 | 2-m-tolyl-1,8-naphthyridine | Drug Info | [39] | |||
35 | 2-methyl-4-(2-thienylethynyl)thiazole | Drug Info | [36] | |||
36 | 2-methyl-4-(3-thienylethynyl)thiazole | Drug Info | [36] | |||
37 | 2-methyl-4-(m-tolylethynyl)thiazole | Drug Info | [36] | |||
38 | 2-Methyl-4-o-tolylethynyl-thiazole | Drug Info | [38] | |||
39 | 2-Methyl-4-p-tolylethynyl-thiazole | Drug Info | [38] | |||
40 | 2-Methyl-4-phenylethynyl-thiazole | Drug Info | [38] | |||
41 | 2-methyl-6-(3-(p-tolyloxy)prop-1-ynyl)pyridine | Drug Info | [41] | |||
42 | 2-methyl-6-(3-(phenylthio)prop-1-ynyl)pyridine | Drug Info | [43] | |||
43 | 2-methyl-6-(4-phenylbut-1-ynyl)pyridine | Drug Info | [43] | |||
44 | 2-methyl-6-(4-phenylpent-1-ynyl)pyridine | Drug Info | [43] | |||
45 | 2-methyl-6-(5-phenylpent-1-ynyl)pyridine | Drug Info | [43] | |||
46 | 2-methyl-6-(phenylethynyl)pyridine | Drug Info | [49], [50] | |||
47 | 2-methyl-7-(pyridin-3-yl)quinoline | Drug Info | [33] | |||
48 | 2-methyl-7-m-tolyl-1,6-naphthyridine | Drug Info | [39] | |||
49 | 2-methyl-7-m-tolyl-1,8-naphthyridine | Drug Info | [39] | |||
50 | 2-methyl-7-m-tolylquinoline | Drug Info | [33] | |||
51 | 2-methyl-7-phenyl-1,8-naphthyridine | Drug Info | [39] | |||
52 | 2-methyl-7-phenylquinoline | Drug Info | [33] | |||
53 | 2-phenyl-1,8-naphthyridine | Drug Info | [39] | |||
54 | 2-Phenyl-5-(2-methylthiazol-4ylethynyl)pyridine | Drug Info | [51] | |||
55 | 2-phenylethynyl-5,6,7,8-tetrahydro-quinolin-5-ol | Drug Info | [46] | |||
56 | 2-phenylethynyl-5,6,7,8-tetrahydro-quinoline | Drug Info | [46] | |||
57 | 2-phenylethynyl-7,8-dihydro-6H-quinolin-5-one | Drug Info | [46] | |||
58 | 2-[(2-methyl-4-thiazolyl)ethynyl]pyrazine | Drug Info | [36] | |||
59 | 3-(1,5-naphthyridin-3-yl)benzonitrile | Drug Info | [39] | |||
60 | 3-(1,8-naphthyridin-2-yl)benzonitrile | Drug Info | [39] | |||
61 | 3-(1-Pyridin-2-yl-1H-pyrazol-3-yl)-benzonitrile | Drug Info | [53] | |||
62 | 3-(1-Pyridin-2-yl-1H-pyrazol-4-yl)-benzonitrile | Drug Info | [53] | |||
63 | 3-(1-Pyridin-2-yl-1H-pyrrol-3-yl)-benzonitrile | Drug Info | [53] | |||
64 | 3-(2-methylbenzo[d]thiazol-5-yl)benzonitrile | Drug Info | [54] | |||
65 | 3-(2-methylquinolin-7-yl)benzonitrile | Drug Info | [33] | |||
66 | 3-(2-methylquinolin-7-yl)phenol | Drug Info | [33] | |||
67 | 3-(2-Pyridin-2-yl-2H-tetrazol-5-yl)-benzonitrile | Drug Info | [53] | |||
68 | 3-(3,4-dimethylphenyl)-1,5-naphthyridine | Drug Info | [39] | |||
69 | 3-(3-(3-chlorobenzyloxy)-5-methylphenyl)pyridine | Drug Info | [42] | |||
70 | 3-(3-bromophenylethynyl)-5-methyl[1,2,4]triazine | Drug Info | [55] | |||
71 | 3-(3-methylphenylethynyl)-5-methyl[1,2,4]triazine | Drug Info | [55] | |||
72 | 3-(3-Pyridin-2-yl-pyrazol-1-yl)-benzonitrile | Drug Info | [53] | |||
73 | 3-(3-Pyridin-2-yl-pyrrol-1-yl)-benzonitrile | Drug Info | [53] | |||
74 | 3-(4-Pyridin-2-yl-imidazol-1-yl)-benzonitrile | Drug Info | [53] | |||
75 | 3-(4-Pyridin-2-yl-pyrazol-1-yl)-benzonitrile | Drug Info | [53] | |||
76 | 3-(5-Pyridin-2-yl-tetrazol-2-yl)-benzonitrile | Drug Info | [53] | |||
77 | 3-(6-fluoroquinazolin-4-ylamino)benzonitrile | Drug Info | [50] | |||
78 | 3-(7-methyl-1,8-naphthyridin-2-yl)benzonitrile | Drug Info | [39] | |||
79 | 3-biphenyl-4-ylethynyl-5-methyl-[1,2,4]triazine | Drug Info | [55] | |||
80 | 3-bromo-5-(2-methylquinolin-7-yl)benzonitrile | Drug Info | [33] | |||
81 | 3-bromo-5-[(2-methyl-4-thiazolyl)ethynyl]pyridine | Drug Info | [36] | |||
82 | 3-bromo-N-(6-methylpyridin-2-yl)benzamide | Drug Info | [56] | |||
83 | 3-chloro-5-(2-methylquinolin-7-yl)benzonitrile | Drug Info | [33] | |||
84 | 3-chloro-N-(3-isobutyramidophenyl)benzamide | Drug Info | [47] | |||
85 | 3-chloro-N-(4-methylthiazol-2-yl)benzamide | Drug Info | [56] | |||
86 | 3-chloro-N-(6-chloropyridin-2-yl)benzamide | Drug Info | [56] | |||
87 | 3-chloro-N-(6-methylpyridin-2-yl)benzamide | Drug Info | [51] | |||
88 | 3-cyano-5-fluoro-N-(3-fluorophenyl)benzamide | Drug Info | [57] | |||
89 | 3-cyano-5-fluoro-N-(pyridin-2-yl)benzamide | Drug Info | [57] | |||
90 | 3-cyano-5-fluoro-N-m-tolylbenzamide | Drug Info | [57] | |||
91 | 3-cyano-5-fluoro-N-phenylbenzamide | Drug Info | [57] | |||
92 | 3-cyano-N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide | Drug Info | [58], [59] | |||
93 | 3-cyano-N-(1,4-diphenyl-1H-pyrazol-5-yl)benzamide | Drug Info | [59] | |||
94 | 3-cyano-N-(3-cyanophenyl)-5-fluorobenzamide | Drug Info | [57] | |||
95 | 3-cyano-N-(3-ethylphenyl)-5-fluorobenzamide | Drug Info | [57] | |||
96 | 3-cyano-N-(3-ethynylphenyl)-5-fluorobenzamide | Drug Info | [57] | |||
97 | 3-cyano-N-(6-ethylpyridin-2-yl)-5-fluorobenzamide | Drug Info | [57] | |||
98 | 3-cyano-N-(6-methylpyridin-2-yl)benzamide | Drug Info | [51] | |||
99 | 3-ethoxy-5-(2-methylquinolin-7-yl)benzonitrile | Drug Info | [33] | |||
100 | 3-fluoro-5-(1,6-naphthyridin-7-yl)benzonitrile | Drug Info | [39] | |||
101 | 3-fluoro-5-(2-methylquinolin-7-yl)benzonitrile | Drug Info | [33] | |||
102 | 3-hydroxy-5-(2-methylquinolin-7-yl)benzonitrile | Drug Info | [33] | |||
103 | 3-iodo-N-(6-methylpyridin-2-yl)benzamide | Drug Info | [56] | |||
104 | 3-isobutoxy-5-(2-methylquinolin-7-yl)benzonitrile | Drug Info | [33] | |||
105 | 3-m-tolyl-1,5-naphthyridine | Drug Info | [39] | |||
106 | 3-methoxy-5-(1,5-naphthyridin-3-yl)benzonitrile | Drug Info | [39] | |||
107 | 3-methoxy-5-(1,6-naphthyridin-7-yl)benzonitrile | Drug Info | [39] | |||
108 | 3-methoxy-5-(2-methylquinolin-7-yl)benzonitrile | Drug Info | [33] | |||
109 | 3-methoxy-N-(4-methylthiazol-2-yl)benzamide | Drug Info | [56] | |||
110 | 3-methoxy-N-(6-methylpyridin-2-yl)benzamide | Drug Info | [56] | |||
111 | 3-methyl-5-(2-methylquinolin-7-yl)benzonitrile | Drug Info | [33] | |||
112 | 3-methyl-N-(6-methylpyridin-2-yl)benzamide | Drug Info | [56] | |||
113 | 3-nitro-N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide | Drug Info | [59] | |||
114 | 3-Phenyl-1-(2-methylthiazol-4-ylethynyl)benzene | Drug Info | [51] | |||
115 | 3-[(2,5-dimethyl-4-thiazolyl)ethynyl]pyridine | Drug Info | [36] | |||
116 | 3-[(2-methyl-4-thiazolyl)ethynyl]-5-vinylpyridine | Drug Info | [36] | |||
117 | 3-[(2-methyl-4-thiazolyl)ethynyl]benzamide | Drug Info | [36] | |||
118 | 3-[(2-methyl-4-thiazolyl)ethynyl]benzonitrile | Drug Info | [36], [60] | |||
119 | 3-[(2-methyl-4-thiazolyl)ethynyl]phenol | Drug Info | [36] | |||
120 | 3-[(5-ethyl-2-methyl-4-thiazolyl)ethynyl]pyridine | Drug Info | [36] | |||
121 | 3-[(6-Methylpyridin-2-yl)ethynyl]benzonitrile | Drug Info | [51] | |||
122 | 4-(2-(3-fluorophenyl)ethynyl)-2-methylthiazole | Drug Info | [36] | |||
123 | 4-(2-(4-fluorophenyl)ethynyl)-2-methylthiazole | Drug Info | [36] | |||
124 | 4-(2-fluorophenylethynyl)-2-methylthiazole | Drug Info | [36] | |||
125 | 4-(2-methoxyphenylethynyl)-2-methylthiazole | Drug Info | [36] | |||
126 | 4-(2-Methyl-thiazol-4-ylethynyl)-pyridine | Drug Info | [38] | |||
127 | 4-(3,5-difluorophenylethynyl)-2-methylthiazole | Drug Info | [36] | |||
128 | 4-(3-bromophenoxy)-6-chloroquinazoline | Drug Info | [50] | |||
129 | 4-(3-bromophenylthio)-2-(pyridin-2-yl)pyrimidine | Drug Info | [45] | |||
130 | 4-(3-chlorophenylethynyl)-2-methylthiazole | Drug Info | [36] | |||
131 | 4-(3-chlorophenylthio)-2-(pyridin-2-yl)pyrimidine | Drug Info | [45] | |||
132 | 4-(3-fluorophenylethynyl)-2-thiazolylamine | Drug Info | [36] | |||
133 | 4-(3-methoxyphenylethynyl)-2-methylthiazole | Drug Info | [36] | |||
134 | 4-(3-pyridylethynyl)-2-thiazolylamine | Drug Info | [36] | |||
135 | 4-(4-chlorophenylthio)-2-(pyridin-2-yl)pyrimidine | Drug Info | [45] | |||
136 | 4-Biphenyl-2-ylethynyl-2-methyl-thiazole | Drug Info | [38] | |||
137 | 4-Biphenyl-4-ylethynyl-2-methyl-thiazole | Drug Info | [38] | |||
138 | 4-cyano-N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide | Drug Info | [59] | |||
139 | 5-((6-Methylpyridin-2-yl)ethynyl)nicotinonitrile | Drug Info | [25] | |||
140 | 5-(2-(2,5-dimethylphenyl)ethynyl)pyrimidine | Drug Info | [61] | |||
141 | 5-(2-(3,5-difluorophenyl)ethynyl)pyrimidine | Drug Info | [61] | |||
142 | 5-(2-(3-chlorophenyl)ethynyl)pyrimidine | Drug Info | [61] | |||
143 | 5-(2-(4-fluoro-3-methylphenyl)ethynyl)pyrimidine | Drug Info | [61] | |||
144 | 5-(2-m-tolylethynyl)pyrimidine | Drug Info | [61] | |||
145 | 5-(2-Methylquinolin-7-yl)-2-phenylbenzonitrile | Drug Info | [25] | |||
146 | 5-(2-Methylquinolin-7-yl)-2-phenylnicotinonitrile | Drug Info | [25] | |||
147 | 5-(2-methylquinolin-7-yl)isophthalonitrile | Drug Info | [33] | |||
148 | 5-(2-methylquinolin-7-yl)nicotinonitrile | Drug Info | [33] | |||
149 | 5-(3-chlorophenylethynyl)-5-methyl[1,2,4]triazine | Drug Info | [55] | |||
150 | 5-(phenylethynyl)pyrimidine | Drug Info | [61] | |||
151 | 5-Biphenyl-4-ylethynyl-pyrimidine | Drug Info | [61] | |||
152 | 5-Chloro-2-(2-methylquinolin-7-yl)benzonitrile | Drug Info | [25] | |||
153 | 5-methyl-3-phenylethynyl[1,2,4]triazine | Drug Info | [55] | |||
154 | 5-[(2-methyl-4-thiazolyl)ethynyl]pyrimidine | Drug Info | [36] | |||
155 | 6-(4-chlorophenylamino)-N,N-diethylnicotinamide | Drug Info | [64] | |||
156 | 6-bromo-N-(3-bromophenyl)quinazolin-4-amine | Drug Info | [50] | |||
157 | 6-bromo-N-(3-chlorophenyl)quinazolin-4-amine | Drug Info | [50] | |||
158 | 6-bromo-N-(3-fluorophenyl)quinazolin-4-amine | Drug Info | [50] | |||
159 | 6-bromo-N-m-tolylquinazolin-4-amine | Drug Info | [50] | |||
160 | 6-chloro-N-(3-chlorophenyl)quinazolin-4-amine | Drug Info | [50] | |||
161 | 6-fluoro-N-m-tolylquinazolin-4-amine | Drug Info | [50] | |||
162 | 6-phenylethynyl-nicotinic acid methyl ester | Drug Info | [46] | |||
163 | 7-(2-methoxyphenyl)-2-methylquinoline | Drug Info | [33] | |||
164 | 7-(3,5-dimethoxyphenyl)-1,6-naphthyridine | Drug Info | [39] | |||
165 | 7-(3-(methoxymethyl)phenyl)-2-methylquinoline | Drug Info | [33] | |||
166 | 7-(3-chlorophenyl)-2-methylquinoline | Drug Info | [33] | |||
167 | 7-(3-fluoro-5-methylphenyl)-1,6-naphthyridine | Drug Info | [39] | |||
168 | 7-(3-fluorophenyl)-2-methylquinoline | Drug Info | [33] | |||
169 | 7-(3-methoxyphenyl)-2-methyl-1,6-naphthyridine | Drug Info | [39] | |||
170 | 7-(3-methoxyphenyl)-2-methylquinoline | Drug Info | [33] | |||
171 | 7-(4,6-dimethoxypyrimidin-2-yl)-2-methylquinoline | Drug Info | [54] | |||
172 | 7-(4,6-dimethylpyrimidin-2-yl)-2-methylquinoline | Drug Info | [54] | |||
173 | 7-(4-methoxyphenyl)-2-methylquinoline | Drug Info | [33] | |||
174 | 7-(4-methoxypyrimidin-2-yl)-2-methylquinoline | Drug Info | [54] | |||
175 | 7-bromo-N-(3-bromophenyl)isoquinolin-1-amine | Drug Info | [50] | |||
176 | 7-m-tolyl-1,6-naphthyridine | Drug Info | [39] | |||
177 | 7-methyl-2-m-tolylpyrido[2,3-d]pyrimidine | Drug Info | [40] | |||
178 | 7-methyl-2-phenylpyrido[2,3-d]pyrimidine | Drug Info | [40] | |||
179 | N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide | Drug Info | [59] | |||
180 | N-(1,4-diphenyl-1H-pyrazol-5-yl)benzamide | Drug Info | [59] | |||
181 | N-(2-phenylimidazo[1,2-a]pyridin-3-yl)benzamide | Drug Info | [59] | |||
182 | N-(3-(3-cyanobenzamido)phenyl)-2-methoxybenzamide | Drug Info | [47] | |||
183 | N-(3-acetamidophenyl)-3-chlorobenzamide | Drug Info | [47] | |||
184 | N-(3-bromophenyl)-6-chloroquinazolin-4-amine | Drug Info | [50] | |||
185 | N-(3-bromophenyl)-6-fluoroquinazolin-4-amine | Drug Info | [50] | |||
186 | N-(3-chlorophenyl)-3-cyano-5-fluorobenzamide | Drug Info | [57] | |||
187 | N-(3-chlorophenyl)-6-fluoroquinazolin-4-amine | Drug Info | [50] | |||
188 | N-(3-chlorophenyl)-6-methoxyquinazolin-4-amine | Drug Info | [50] | |||
189 | N-(3-chlorophenyl)-6-nitroquinazolin-4-amine | Drug Info | [50] | |||
190 | N-(6-methylpyridin-2-yl)-5-phenylpicolinamide | Drug Info | [72] | |||
191 | N-(6-methylpyridin-2-yl)-6-phenylnicotinamide | Drug Info | [51] | |||
192 | N-(6-methylpyridin-2-yl)biphenyl-3-carboxamide | Drug Info | [51] | |||
193 | N-cyclopentyl-6-(2-phenylethynyl)nicotinamide | Drug Info | [73] | |||
194 | N-[4-(3-pyridylethynyl)-2-thiazolyl]acetamide | Drug Info | [36] | |||
195 | SIB-1757 | Drug Info | [56] | |||
196 | SIB-1893 | Drug Info | [56] | |||
197 | [3H]quisqualate | Drug Info | [96] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: AFQ056 | Ligand Info | |||||
Structure Description | Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane domain in complex with the negative allosteric modulator mavoglurant | PDB:4OO9 | ||||
Method | X-ray diffraction | Resolution | 2.60 Å | Mutation | Yes | [97] |
PDB Sequence |
SPVQYLRWGD
577 PAPIAAVVFA587 CLGLLATLFV597 TVVFIIYRDT607 PVVKSSSREL617 CYIILAGICL 627 GYLCTFLIAK638 PKQIYCYLQR648 IGIGLSPAMS658 YSALVTKTYR668 AARILAMSKK 678 NIFEMLRIDE1011 GLRLKIYKDT1021 EGYYTIGIGH1031 LLTKSPSLNA1041 AKSELDKAIG 1051 RNTNGVITKD1061 EAEKLFNQDV1071 DAAVRGILRN1081 AKLKPVYDSL1091 DAVRRAALIN 1101 MVFQMGETGV1111 AGFTNSLRML1121 QQKRWDEAAV1131 NLAKSRWYNQ1141 TPNRAKRVIT 1151 TFRTGTWDAY1161 KISAAQLVIA697 FILICIQLGI707 IVALFIMEPP717 DIMVYLICNT 735 TNLGVVAPLG745 YNGLLILACT755 FYAFKTRNVP765 ANFNEAKYIA775 FTMYTTCIIW 785 LAFVPIYFGS795 NYKIITMCFS805 VSLSATVALG815 CMFVPKVYII825 LAKPERN |
|||||
|
GLY624
3.547
ILE625
3.781
GLY628
4.118
ILE651
3.584
GLY652
4.620
SER654
3.671
PRO655
3.557
SER658
3.502
TYR659
3.238
VAL740
3.568
PRO743
3.406
LEU744
3.449
|
|||||
Ligand Name: [3H]LY341495 | Ligand Info | |||||
Structure Description | Thermostabilised full length human mGluR5-5M with orthosteric antagonist, LY341495 | PDB:7FD9 | ||||
Method | Electron microscopy | Resolution | 4.00 Å | Mutation | Yes | [98] |
PDB Sequence |
RRVVAHMPGD
34 IIIGALFSVH44 HQPTVDKVHE54 RKCGAVREQY64 GIQRVEAMLH74 TLERINSDPT 84 LLPNITLGCE94 IRDSCWHSAV104 ALEQSIEFIR114 DSLISSKKPI143 VGVIGPGSSS 153 VAIQVQNLLQ163 LFNIPQIAYS173 ATSMDLSDKT183 LFKYFMRVVP193 SDAQQARAMV 203 DIVKRYNWTY213 VSAVHTEGNY223 GESGMEAFKD233 MSAKEGICIA243 HSYKIYSNAG 253 EQSFDKLLKK263 LTSHLPKARV273 VACFCEGMTV283 RGLLMAMRRL293 GLAGEFLLLG 303 SDGWADRYDV313 TDGYQREAVG323 GITIKLQSPD333 VKWFDDYYLK343 LRPETNLRNP 353 WFQEFWQHRF363 QCRLEGFPQE373 NSKYNKTCNS383 SLTLKTHHVQ393 DSKMGFVINA 403 IYSMAYGLHN413 MQMSLCPGYA423 GLCDAMKPID433 GRKLLESLMK443 TAFTGVSGDT 453 ILFDENGDSP463 GRYEIMNFKE473 MGKDYFDYIN483 VGSWDNGELK493 MDDDEVWSKK 503 SNIIRSVCSE513 PCEKGQIKVI523 RKGEVSCCWT533 CTPCKENEYV543 FDEYTCKACQ 553 LGSWPTDDLT563 GCDLIPVQYL573 RWGDPEPIAA583 VVFACLGLLA593 TLFVTVVFII 603 YRDTPVVKSS613 SRELCYIILA623 GICLGYLCTF633 CLIAKPKQIY643 CYLQRIGIGL 653 SPAMSYSALV663 TKTNRIARIL673 ACAQLVIAFI699 LICIQLGIIV709 ALFIMEPPDI 719 MHDYPSIREV729 YLICNTTNLG739 VVAPLGYNGL749 LILACTFYAF759 KTRNVPANFN 769 EAKYIAFAMY779 TTCIIWLAFV789 PIYFGSNYKA799 ITMCFSVSLS809 ATVLLGCMFV 819 PKVYIIL
|
|||||
|
||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Tissue Distribution
Human Pathway Affiliation
Biological Network Descriptors
|
There is no similarity protein (E value < 0.005) for this target
|
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Calcium signaling pathway | hsa04020 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Phospholipase D signaling pathway | hsa04072 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
|
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
Gap junction | hsa04540 | Affiliated Target |
|
Class: Cellular Processes => Cellular community - eukaryotes | Pathway Hierarchy | ||
Long-term potentiation | hsa04720 | Affiliated Target |
|
Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
Retrograde endocannabinoid signaling | hsa04723 | Affiliated Target |
|
Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
Glutamatergic synapse | hsa04724 | Affiliated Target |
|
Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
Click to Show/Hide the Information of Affiliated Human Pathways |
Degree | 8 | Degree centrality | 8.59E-04 | Betweenness centrality | 9.13E-04 |
---|---|---|---|---|---|
Closeness centrality | 2.28E-01 | Radiality | 1.40E+01 | Clustering coefficient | 1.43E-01 |
Neighborhood connectivity | 3.20E+01 | Topological coefficient | 1.37E-01 | Eccentricity | 12 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 7 KEGG Pathways | + | ||||
1 | Calcium signaling pathway | |||||
2 | Neuroactive ligand-receptor interaction | |||||
3 | Gap junction | |||||
4 | Long-term potentiation | |||||
5 | Retrograde endocannabinoid signaling | |||||
6 | Glutamatergic synapse | |||||
7 | Huntington's disease | |||||
Panther Pathway | [+] 4 Panther Pathways | + | ||||
1 | Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
2 | Metabotropic glutamate receptor group III pathway | |||||
3 | Metabotropic glutamate receptor group I pathway | |||||
4 | Endogenous cannabinoid signaling | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | G alpha (q) signalling events | |||||
2 | Class C/3 (Metabotropic glutamate/pheromone receptors) | |||||
WikiPathways | [+] 5 WikiPathways | + | ||||
1 | Hypothetical Network for Drug Addiction | |||||
2 | GPCRs, Class C Metabotropic glutamate, pheromone | |||||
3 | Gastrin-CREB signalling pathway via PKC and MAPK | |||||
4 | GPCR ligand binding | |||||
5 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Metabolism and disposition of the metabotropic glutamate receptor 5 antagonist (mGluR5) mavoglurant (AFQ056) in healthy subjects. Drug Metab Dispos. 2013 Sep;41(9):1626-41. | |||||
REF 2 | ClinicalTrials.gov (NCT04857359) Dipraglurant (ADX48621) for the Treatment of Patients With Parkinson's Disease Receiving Levodopa-based Therapy. U.S. National Institutes of Health. | |||||
REF 3 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7586). | |||||
REF 4 | ClinicalTrials.gov (NCT01433354) Long-term, Safety and Tolerability Study of AFQ056 in Adolescent Patients With Fragile X Syndrome (Open-label). U.S. National Institutes of Health. | |||||
REF 5 | ClinicalTrials.gov (NCT00820105) ADX10059 Migraine Prevention Study. U.S. National Institutes of Health. | |||||
REF 6 | ClinicalTrials.gov (NCT01750957) A Study of RO4917523 in Pediatric Patients With Fragile X Syndrome. U.S. National Institutes of Health. | |||||
REF 7 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3336). | |||||
REF 8 | ClinicalTrials.gov (NCT01325740) A Study to Assess the Tolerability of a Single Dose of STX107 in Adults With Fragile X Syndrome. U.S. National Institutes of Health. | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1434). | |||||
REF 10 | ClinicalTrials.gov (NCT00637221) Open Label Study Investigating Safety and Efficacy of NPL2009 50 mg - 150 mg on Prepulse Inhibition Tests and Continuous Performance Tasks, Adults With Fragile X Syndrome. U.S. National Institutes of Health. | |||||
REF 11 | ClinicalTrials.gov (NCT05804383) A Phase 1B Multiple Ascending Dose Study of The Safety and Tolerability of BMS-984923 in Healthy Older Adults and Patients With Alzheimer's Disease. U.S.National Institutes of Health. | |||||
REF 12 | ClinicalTrials.gov (NCT04805983) An Open-Label, Single-Ascending Dose Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Receptor Occupancy of BMS-984923. U.S.National Institutes of Health. | |||||
REF 13 | ClinicalTrials.gov (NCT00954538) Safety, Radiation Dosimetry, Biokinetics, and Effectiveness of [18F]MK3328 (MK-3328-001). U.S. National Institutes of Health. | |||||
REF 14 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800040973) | |||||
REF 15 | ClinicalTrials.gov (NCT01981395) Fenobam on Heat/Capsaicin Induced Hyperalgesia in Healthy Volunteers. U.S. National Institutes of Health. | |||||
REF 16 | mGlu5 negative allosteric modulators: a patent review (2013 - 2016).Expert Opin Ther Pat. 2017 Jun;27(6):691-706. | |||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027605) | |||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029648) | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015556) | |||||
REF 20 | Pipeline of Addex Pharma. Addex Pharma. 2009. | |||||
REF 21 | A proof-of-concept study evaluating the effect of ADX10059, a metabotropic glutamate receptor-5 negative allosteric modulator, on acid exposure and... Gut. 2009 Sep;58(9):1192-9. | |||||
REF 22 | Novel treatments of GERD: focus on the lower esophageal sphincter. Eur Rev Med Pharmacol Sci. 2008 Aug;12 Suppl 1:103-10. | |||||
REF 23 | The challenges of clinical trials in fragile X syndrome. Psychopharmacology (Berl) 2014; 231(6): 1237-1250. | |||||
REF 24 | Social Communication is an Emerging Target for Pharmacotherapy in Autism Spectrum Disorder - A Review of the Literature on Potential Agents. J Can Acad Child Adolesc Psychiatry. 2014 February; 23(1):20-30. | |||||
REF 25 | Structure-activity relationships in a novel series of 7-substituted-aryl quinolines and 5-substituted-aryl benzothiazoles at the metabotropic gluta... Bioorg Med Chem. 2010 May 1;18(9):3026-35. | |||||
REF 26 | Glutamate- and GABA-based CNS therapeutics. Curr Opin Pharmacol. 2006 Feb;6(1):7-17. | |||||
REF 27 | Silent Allosteric Modulation of mGluR5 Maintains Glutamate Signaling while Rescuing Alzheimer's Mouse Phenotypes. Cell Rep. 2017 Jul 5;20(1):76-88. | |||||
REF 28 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 293). | |||||
REF 29 | Clinical pipeline report, company report or official report of Roche. | |||||
REF 30 | Fenobam: a clinically validated nonbenzodiazepine anxiolytic is a potent, selective, and noncompetitive mGlu5 receptor antagonist with inverse agon... J Pharmacol Exp Ther. 2005 Nov;315(2):711-21. | |||||
REF 31 | Clinical pipeline report, company report or official report of AstraZeneca (2009). | |||||
REF 32 | Characterization of [(3)H]Quisqualate binding to recombinant rat metabotropic glutamate 1a and 5a receptors and to rat and human brain sections. J Neurochem. 2000 Dec;75(6):2590-601. | |||||
REF 33 | Rational design of 7-arylquinolines as non-competitive metabotropic glutamate receptor subtype 5 antagonists. Bioorg Med Chem Lett. 2007 Aug 15;17(16):4415-8. | |||||
REF 34 | Dipyridyl amines: potent metabotropic glutamate subtype 5 receptor antagonists. Bioorg Med Chem Lett. 2005 Oct 1;15(19):4350-3. | |||||
REF 35 | Synergism of virtual screening and medicinal chemistry: identification and optimization of allosteric antagonists of metabotropic glutamate recepto... Bioorg Med Chem. 2009 Aug 1;17(15):5708-15. | |||||
REF 36 | Synthesis and structure-activity relationships of 3-[(2-methyl-1,3-thiazol-4-yl)ethynyl]pyridine analogues as potent, noncompetitive metabotropic g... J Med Chem. 2006 Feb 9;49(3):1080-100. | |||||
REF 37 | Biochemical and electrophysiological studies on (S)-(+)-2-(3'-carboxybicyclo(1.1.1)pentyl)-glycine (CBPG), a novel mGlu5 receptor agonist endowed with mGlu1 receptor antagonist activity. Neuropharmacology. 1999 Jul;38(7):917-26. | |||||
REF 38 | 5-[(2-Methyl-1,3-thiazol-4-yl)ethynyl]-2,3'-bipyridine: a highly potent, orally active metabotropic glutamate subtype 5 (mGlu5) receptor antagonist... Bioorg Med Chem Lett. 2004 Aug 2;14(15):3993-6. | |||||
REF 39 | Synthesis and SAR comparison of regioisomeric aryl naphthyridines as potent mGlu5 receptor antagonists. Bioorg Med Chem Lett. 2007 Dec 1;17(23):6525-8. | |||||
REF 40 | Synthesis and SAR of 2-aryl pyrido[2,3-d]pyrimidines as potent mGlu5 receptor antagonists. Bioorg Med Chem Lett. 2007 Oct 1;17(19):5396-9. | |||||
REF 41 | A new series of pyridinyl-alkynes as antagonists of the metabotropic glutamate receptor 5 (mGluR5). Bioorg Med Chem Lett. 2006 Sep 15;16(18):4792-5. | |||||
REF 42 | Arylmethoxypyridines as novel, potent and orally active mGlu5 receptor antagonists. Bioorg Med Chem Lett. 2006 Apr 1;16(7):1892-7. | |||||
REF 43 | Structure-activity relationships for the linker in a series of pyridinyl-alkynes that are antagonists of the metabotropic glutamate receptor 5 (mGl... Bioorg Med Chem Lett. 2006 Sep 15;16(18):4788-91. | |||||
REF 44 | Discovery of molecular switches that modulate modes of metabotropic glutamate receptor subtype 5 (mGlu5) pharmacology in vitro and in vivo within a... J Med Chem. 2009 Jul 23;52(14):4103-6. | |||||
REF 45 | Structure-activity relationship of thiopyrimidines as mGluR5 antagonists. Bioorg Med Chem Lett. 2006 May 1;16(9):2467-9. | |||||
REF 46 | Positive and negative modulation of group I metabotropic glutamate receptors. J Med Chem. 2008 Feb 14;51(3):634-47. | |||||
REF 47 | Synthesis and SAR of novel, non-MPEP chemotype mGluR5 NAMs identified by functional HTS. Bioorg Med Chem Lett. 2009 Dec 1;19(23):6502-6. | |||||
REF 48 | Cyclohexenyl- and dehydropiperidinyl-alkynyl pyridines as potent metabotropic glutamate subtype 5 (mGlu5) receptor antagonists. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4589-93. | |||||
REF 49 | 2-Methyl-6-(phenylethynyl)-pyridine (MPEP), a potent, selective and systemically active mGlu5 receptor antagonist. Neuropharmacology. 1999 Oct;38(10):1493-503. | |||||
REF 50 | Discovery and SAR of 6-substituted-4-anilinoquinazolines as non-competitive antagonists of mGlu5. Bioorg Med Chem Lett. 2009 Dec 1;19(23):6623-6. | |||||
REF 51 | Structure-activity relationships comparing N-(6-methylpyridin-yl)-substituted aryl amides to 2-methyl-6-(substituted-arylethynyl)pyridines or 2-met... J Med Chem. 2009 Jun 11;52(11):3563-75. | |||||
REF 52 | A family of highly selective allosteric modulators of the metabotropic glutamate receptor subtype 5. Mol Pharmacol. 2003 Sep;64(3):731-40. | |||||
REF 53 | Discovery of novel heteroarylazoles that are metabotropic glutamate subtype 5 receptor antagonists with anxiolytic activity. J Med Chem. 2004 Sep 9;47(19):4645-8. Letter | |||||
REF 54 | Discovery of heterobicyclic templates for novel metabotropic glutamate receptor subtype 5 antagonists. Bioorg Med Chem Lett. 2007 Jun 1;17(11):2987-91. | |||||
REF 55 | Synthesis and pharmacological evaluation of phenylethynyl[1,2,4]methyltriazines as analogues of 3-methyl-6-(phenylethynyl)pyridine. J Med Chem. 2007 Jul 12;50(14):3388-91. | |||||
REF 56 | Design and synthesis of noncompetitive metabotropic glutamate receptor subtype 5 antagonists. Bioorg Med Chem Lett. 2006 Jul 1;16(13):3371-5. | |||||
REF 57 | 3-Cyano-5-fluoro-N-arylbenzamides as negative allosteric modulators of mGlu(5): Identification of easily prepared tool compounds with CNS exposure ... Bioorg Med Chem Lett. 2010 Aug 1;20(15):4390-4. | |||||
REF 58 | Discovery of positive allosteric modulators for the metabotropic glutamate receptor subtype 5 from a series of N-(1,3-diphenyl-1H- pyrazol-5-yl)benzamides that potentiate receptor function in vivo. JMed Chem. 2004 Nov 18;47(24):5825-8. | |||||
REF 59 | Substituent effects of N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamides on positive allosteric modulation of the metabotropic glutamate-5 receptor in rat... J Med Chem. 2006 Jun 1;49(11):3332-44. | |||||
REF 60 | Discovery of novel modulators of metabotropic glutamate receptor subtype-5. Bioorg Med Chem. 2004 Jan 2;12(1):17-21. | |||||
REF 61 | Synthesis and SAR of a mGluR5 allosteric partial antagonist lead: unexpected modulation of pharmacology with slight structural modifications to a 5... Bioorg Med Chem Lett. 2008 Jul 15;18(14):4098-101. | |||||
REF 62 | A close structural analog of 2-methyl-6-(phenylethynyl)-pyridine acts as a neutral allosteric site ligand on metabotropic glutamate receptor subtyp... Mol Pharmacol. 2005 Dec;68(6):1793-802. | |||||
REF 63 | Mechanism based neurotoxicity of mGlu5 positive allosteric modulators--development challenges for a promising novel antipsychotic target. Neuropharmacology. 2014 Jul;82:161-73. | |||||
REF 64 | Piperidyl amides as novel, potent and orally active mGlu5 receptor antagonists with anxiolytic-like activity. Bioorg Med Chem Lett. 2010 Jan 1;20(1):184-8. | |||||
REF 65 | Dipyridyl amides: potent metabotropic glutamate subtype 5 (mGlu5) receptor antagonists. Bioorg Med Chem Lett. 2005 Feb 15;15(4):1197-200. | |||||
REF 66 | An allosteric modulator to control endogenous G protein-coupled receptors with light. Nat Chem Biol. 2014 Oct;10(10):813-5. | |||||
REF 67 | A novel selective allosteric modulator potentiates the activity of native metabotropic glutamate receptor subtype 5 in rat forebrain. J Pharmacol Exp Ther. 2004 May;309(2):568-77. | |||||
REF 68 | Preclinical profile of a novel metabotropic glutamate receptor 5 positive allosteric modulator. Eur J Pharmacol. 2011 Jun 1;659(2-3):146-54. | |||||
REF 69 | CTEP: a novel, potent, long-acting, and orally bioavailable metabotropic glutamate receptor 5 inhibitor. J Pharmacol Exp Ther. 2011 Nov;339(2):474-86. | |||||
REF 70 | In vitro characterisation of the novel positive allosteric modulators of the mGlu receptor, LSN2463359 and LSN2814617, and their effects on sleep architecture and operant responding in the rat. Neuropharmacology. 2013 Jan;64:224-39. | |||||
REF 71 | Inhibition of group I metabotropic glutamate receptor responses in vivo in rats by a new generation of carboxyphenylglycine-like amino acid antagon... Neurosci Lett. 2002 Sep 20;330(2):127-30. | |||||
REF 72 | Design and synthesis of novel heterobiaryl amides as metabotropic glutamate receptor subtype 5 antagonists. Bioorg Med Chem Lett. 2007 Apr 1;17(7):2074-9. | |||||
REF 73 | Discovery of a potent and brain penetrant mGluR5 positive allosteric modulator. Bioorg Med Chem Lett. 2009 Jun 15;19(12):3275-8. | |||||
REF 74 | A novel metabotropic glutamate receptor 5 positive allosteric modulator acts at a unique site and confers stimulus bias to mGlu5 signaling. Mol Pharmacol. 2013 Apr;83(4):835-47. | |||||
REF 75 | 2-(2-[3-(pyridin-3-yloxy)phenyl]-2H-tetrazol-5-yl) pyridine: a highly potent, orally active, metabotropic glutamate subtype 5 (mGlu5) receptor antagonist. Bioorg Med Chem Lett. 2004 Nov 15;14(22):5473-6. | |||||
REF 76 | Discovery of highly potent, selective, orally bioavailable, metabotropic glutamate subtype 5 (mGlu5) receptor antagonists devoid of cytochrome P450 1A2 inhibitory activity. Bioorg Med Chem Lett. 2004Nov 15;14(22):5481-4. | |||||
REF 77 | Rational design, synthesis, and structure-activity relationship of benzoxazolones: new potent mglu5 receptor antagonists based on the fenobam struc... Bioorg Med Chem Lett. 2007 Mar 1;17(5):1302-6. | |||||
REF 78 | Design, synthesis, and structure-activity relationships of novel bicyclic azole-amines as negative allosteric modulators of metabotropic glutamate receptor 5. J Med Chem. 2010 Oct 14;53(19):7107-18. | |||||
REF 79 | Discovery of novel positive allosteric modulators of the metabotropic glutamate receptor 5 (mGlu5). Bioorg Med Chem Lett. 2011 Mar 1;21(5):1402-6. | |||||
REF 80 | 6-Aryl-3-pyrrolidinylpyridines as mGlu5 receptor negative allosteric modulators. Bioorg Med Chem Lett. 2011 Aug 15;21(16):4891-9. | |||||
REF 81 | (3-Cyano-5-fluorophenyl)biaryl negative allosteric modulators of mGlu(5): Discovery of a new tool compound with activity in the OSS mouse model of addiction. ACS Chem Neurosci. 2011 Aug 17;2(8):471-482. | |||||
REF 82 | Discovery and structure-activity relationship of 1,3-cyclohexyl amide derivatives as novel mGluR5 negative allosteric modulators. Bioorg Med Chem Lett. 2013 Mar 1;23(5):1398-406. | |||||
REF 83 | Discovery of (1R,2R)-N-(4-(6-isopropylpyridin-2-yl)-3-(2-methyl-2H-indazol-5-yl)isothiazol-5-yl)-2-methylcyclopropanecarboxamide, a potent and orally efficacious mGlu5 receptor negative allosteric modulator. Bioorg Med Chem Lett. 2013 Mar 1;23(5):1249-52. | |||||
REF 84 | Discovery of biological evaluation of pyrazole/imidazole amides as mGlu5 receptor negative allosteric modulators. Bioorg Med Chem Lett. 2013 Apr 1;23(7):2134-9. | |||||
REF 85 | Synthesis and simple 18F-labeling of 3-fluoro-5-(2-(2-(fluoromethyl)thiazol-4-yl)ethynyl)benzonitrile as a high affinity radioligand for imaging mo... J Med Chem. 2007 Jul 12;50(14):3256-66. | |||||
REF 86 | Functional impact of allosteric agonist activity of selective positive allosteric modulators of metabotropic glutamate receptor subtype 5 in regulating central nervous system function. Mol Pharmacol.2012 Feb;81(2):120-33. | |||||
REF 87 | Discovery of novel allosteric modulators of metabotropic glutamate receptor subtype 5 reveals chemical and functional diversity and in vivo activity in rat behavioral models of anxiolytic and antipsychotic activity. Mol Pharmacol. 2010 Dec;78(6):1105-23. | |||||
REF 88 | Discovery of a Novel Chemical Class of mGlu(5) Allosteric Ligands with Distinct Modes of Pharmacology. ACS Chem Neurosci. 2010 Oct 20;1(10):702-716. | |||||
REF 89 | Discovery of N-Aryl Piperazines as Selective mGlu(5) Potentiators with Efficacy in a Rodent Model Predictive of Anti-Psychotic Activity. ACS Med Chem Lett. 2010 Nov 11;1(8):433-438. | |||||
REF 90 | Discovery of 2-(2-benzoxazoyl amino)-4-aryl-5-cyanopyrimidine as negative allosteric modulators (NAMs) of metabotropic glutamate receptor (mGlu : from an artificial neural network virtual screen to an in vivo tool compound. ChemMedChem. 2012 Mar 5;7(3):406-14. | |||||
REF 91 | Optimization of an ether series of mGlu5 positive allosteric modulators: molecular determinants of MPEP-site interaction crossover. Bioorg Med Chem Lett. 2012 Oct 15;22(20):6481-5. | |||||
REF 92 | Unique signaling profiles of positive allosteric modulators of metabotropic glutamate receptor subtype 5 determine differences in in vivo activity. Biol Psychiatry. 2013 Mar 15;73(6):501-9. | |||||
REF 93 | Substituted 1-Phenyl-3-(pyridin-2-yl)urea negative allosteric modulators of mGlu5: discovery of a new tool compound VU0463841 with activity in rat models of cocaine addiction. ACS Chem Neurosci. 2013Aug 21;4(8):1217-28. | |||||
REF 94 | [3H]Methoxymethyl-3-[(2-methyl-1,3-thiazol-4-yl)ethynyl]pyridine binding to metabotropic glutamate receptor subtype 5 in rodent brain: in vitro and in vivo characterization. J Pharmacol Exp Ther. 2002 Dec;303(3):1044-51. | |||||
REF 95 | [3H]-methoxymethyl-MTEP and [3H]-methoxy-PEPy: potent and selective radioligands for the metabotropic glutamate subtype 5 (mGlu5) receptor. Bioorg Med Chem Lett. 2003 Feb 10;13(3):351-4. | |||||
REF 96 | Excitatory amino acid receptor ligands: resolution, absolute stereochemistry, and enantiopharmacology of 2-amino-3-(4-butyl-3-hydroxyisoxazol-5-yl)... J Med Chem. 1998 Mar 12;41(6):930-9. | |||||
REF 97 | Structure of class C GPCR metabotropic glutamate receptor 5 transmembrane domain. Nature. 2014 Jul 31;511(7511):557-62. | |||||
REF 98 | Agonists and allosteric modulators promote signaling from different metabotropic glutamate receptor 5 conformations. Cell Rep. 2021 Aug 31;36(9):109648. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.