Target Information

Target General Infomation
Target ID
T44011
Former ID
TTDR00587
Target Name
Estradiol 17 beta-dehydrogenase 1
Gene Name
HSD17B1
Synonyms
17-beta-HSD 1; 17-beta-Hydroxysteroid dehydrogenase type 1; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; E2DH; Placental 17-beta-hydroxysteroid dehydrogenase; HSD17B1
Target Type
Clinical Trial
Function
Favors the reduction of estrogens and androgens. Also has 20-alpha-HSD activity. Uses preferentially NADH.
BioChemical Class
Short-chain dehydrogenases reductases
Target Validation
T44011
UniProt ID
P14061
EC Number
EC 1.1.1.62
Sequence
MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL
ETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTV
RMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVH
LSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV
FLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG
GAGPGAEDEAGRGAVGDPELGDPPAAPQ
Structure
1A27; 1BHS; 1DHT; 1EQU; 1FDS; 1FDT; 1FDU; 1FDV; 1FDW; 1I5R; 1IOL; 1JTV; 1QYV; 1QYW; 1QYX; 3DEY; 3DHE; 3HB4; 3HB5; 3KLM; 3KLP; 3KM0
Drugs and Mode of Action
Drug(s) NARINGENIN Drug Info Phase 1 Discovery agent [522980]
Inhibitor 1,1':4',1''-terphenyl-3,3''-diol Drug Info [530450]
1,1':4',1''-terphenyl-3,4''-diol Drug Info [530450]
1-Bromo-6-(3-hydroxyphenyl)-2-naphthol Drug Info [529595]
16-(2',2'-Dimethyl)-propylidene-estradiol Drug Info [528033]
16-(2',2'-Dimethyl)-propylidene-estrone Drug Info [528033]
16-(4-cyano-benzylidene)-estradiol Drug Info [528033]
16-(4-dimethylamino-benzylidene)-estradiol Drug Info [528033]
16-(4-dimethylamino-benzylidene)-estrone Drug Info [528033]
16-(pyridin-2-yl)methyl-estradiol Drug Info [528033]
16-(pyridin-2-yl)methylene-estradiol Drug Info [528033]
16-(pyridin-3-yl)methyl-estradiol Drug Info [528033]
16-(pyridin-3-yl)methylene-estradiol Drug Info [528033]
16-(pyridin-4-yl)methyl-estradiol Drug Info [528033]
16-(pyridin-4-yl)methylene-estradiol Drug Info [528033]
16-(thiophen-2-yl)methylene-estrone Drug Info [528033]
16-beta-ethoxymethyl-estrone Drug Info [528033]
16-beta-hydroxymethyl-estradiol Drug Info [528033]
16-isobutylidene-estradiol Drug Info [528033]
16-isobutylidene-estrone Drug Info [528033]
16beta-cyano-estradiol Drug Info [528033]
2'-Monophosphoadenosine 5'-Diphosphoribose Drug Info [551393]
2-(3-hydroxyphenyl)quinolin-6-ol Drug Info [529359]
2-Fluoro-4-[5-(3-hydroxyphenyl)-2-thienyl]phenol Drug Info [530450]
2-Fluoro-4-[5-(3-hydroxyphenyl)-3-thienyl]phenol Drug Info [530450]
2-Fluoro-5-[5-(4-hydroxyphenyl)-2-thienyl]phenol Drug Info [530450]
2-Hydroxy-N,6-bis(3-hydroxyphenyl)-1-naphthamide Drug Info [529595]
3'-(1-Benzothien-2-yl)biphenyl-3-ol Drug Info [530868]
3'-(5-Chloro-2-thienyl)biphenyl-3-ol Drug Info [530868]
3,3',3''-Thiene-2,3,5-triyltriphenol Drug Info [530450]
3,3'-(1,2,4,5-tetrazine-3,6-diyl)diphenol Drug Info [529748]
3,3'-(1,2,4-Thiadiazol-2,5-diyl)diphenol Drug Info [529748]
3,3'-(1,2,4-thiadiazole-3,5-diyl)diphenol Drug Info [529748]
3,3'-(1,3-Thiazol-2,4-diyl)diphenol Drug Info [529748]
3,3'-(3-Methylthiene-2,5-diyl]diphenol Drug Info [530450]
3,3'-(3-Phenylthiene-2,5-diyl)diphenol Drug Info [530450]
3,3'-pyrazine-2,5-diyldiphenol Drug Info [529748]
3,3'-Pyridine-2,5-diyldiphenol Drug Info [529748]
3,3'-Thiene-2,4-diyldiphenol Drug Info [529748]
3,3'-thiene-2,5-diyldiphenol Drug Info [530450]
3,3-(1,3-Thiazole-2,5-diyl)diphenol Drug Info [529748]
3,4'-(thiophene-2,4-diyl)diphenol Drug Info [530450]
3-(2-naphthyl)phenol Drug Info [529359]
3-(3-hydroxyphenyl)quinolin-7-ol Drug Info [529359]
3-(5-phenyl-2-thienyl)phenol Drug Info [530450]
3-(6-hydroxy-2-naphthyl)benzoic acid Drug Info [529359]
3-Beta-Hydroxy-5-Androsten-17-One Drug Info [551393]
3-Fluoro-5-[5-(4-hydroxyphenyl)-2-thienyl]phenol Drug Info [530450]
3-Hydroxy-7-(3-hydroxyphenyl)-1-naphthonitrile Drug Info [529595]
3-[2-(5-Chloro-2-thienyl)pyridin-4-yl]phenol Drug Info [530868]
3-[3-(4-hydroxyphenyl)isoxazol-5-yl]phenol Drug Info [529504]
3-[4-(4-Hydroxyphenyl)-1,3-oxazol-2-yl]phenol Drug Info [529504]
3-[4-(5-Chloro-2-thienyl)pyridin-2-yl]phenol Drug Info [530868]
3-[5-(3,4-Difluorophenyl)-2-thienyl]phenol Drug Info [530450]
3-[5-(3-Fluorophenyl)-2-thienyl]phenol Drug Info [530450]
3-[5-(4-Fluorophenyl)-2-thienyl]phenol Drug Info [530450]
3-[5-(4-hydroxyphenyl)-1,3-oxazol-2-yl]phenol Drug Info [529748]
3-[5-(4-hydroxyphenyl)-1,3-thiazol-2-yl]phenol Drug Info [530450]
3-[5-(4-Hydroxyphenyl)-2-thienyl]-5-methylphenol Drug Info [530450]
3-[5-(4-hydroxyphenyl)-2-thienyl]phenol Drug Info [530450]
3-[5-(4-Hydroxyphenyl)-3-thienyl]phenol Drug Info [529748]
3-[6-(5-Chloro-2-thienyl)pyridin-2-yl]phenol Drug Info [530868]
4'-(5-Chloro-2-thienyl)biphenyl-3-ol Drug Info [530868]
4'-(6-Methoxypyridin-3-yl)biphenyl-3-ol Drug Info [530868]
4-ANDROSTENE-3-17-DIONE Drug Info [551374]
4-Fluoro-1,1':4',1''-terphenyl-3,3''-diol Drug Info [530450]
4-Methyl-1,1':4',1''-terphenyl-3,4''-diol Drug Info [530450]
4-[5-(3-Hydroxyphenyl)-2-thienyl)-2-methyl]phenol Drug Info [530450]
4-[5-(3-Hydroxyphenyl)-2-thienyl]benzene-1,2-diol Drug Info [530450]
4-[5-(3-Hydroxyphenyl)-3-thienyl]-2-methylphenol Drug Info [530450]
5-(6-hydroxy-2-naphthyl)pyridin-3-ol Drug Info [529359]
5alpha-Androstan-3,17-Dione Drug Info [551393]
6-(3-Hydroxy-phenyl)-naphthalen-2-ol Drug Info [529595]
6-(3-Hydroxyphenyl)-1-phenyl-2-naphthol Drug Info [529595]
6-(4-Hydroxy-phenyl)-naphthalen-1-ol Drug Info [529359]
6-oxo-16-formyl-estrone Drug Info [528033]
6-oxo-estrone Drug Info [528033]
7-(3-Hydroxy-phenyl)-naphthalen-2-ol Drug Info [529359]
7-Hydroxy-3-(3-hydroxyphenyl)-1-naphthonitrile Drug Info [529595]
APIGENIN Drug Info [529519]
EM-1745 Drug Info [551393]
Equilin Drug Info [551393]
Ethyl estrone-16-methylcarboxylate Drug Info [528033]
KAEMPFEROL Drug Info [529519]
Methyl estradiol-16-beta-carboxylate Drug Info [528033]
N,N-diethyl estrone-16-methyl carboxamide Drug Info [528033]
N-(1'-Phenyl-ethyl) estradiol-16-carboxamide Drug Info [528033]
N-(4'-methyl-piperazinyl) estradiol-16-carboxamide Drug Info [528033]
N-(furan-2-ylmethyl)-estrone-16-methyl carboxamide Drug Info [528033]
N-(furan-2-ylmethyl)estradiol-16-carboxamide Drug Info [528033]
N-(pyridin-3-ylmethyl) estradiol-16-carboxamide Drug Info [528033]
N-(pyridin-4-ylmethyl) estradiol-16-carboxamide Drug Info [528033]
N-ethyl estradiol-16-methyl carboxamide Drug Info [528033]
N-ethyl estrone-16-methyl carboxamide Drug Info [528033]
N-isopropyl estradiol-16-carboxamide Drug Info [528033]
N-isopropyl estradiol-16-methyl carboxamide Drug Info [528033]
N-isopropyl estrone-16-methyl carboxamide Drug Info [528033]
N-methoxyethyl estrone-16-methyl carboxamide Drug Info [528033]
N-methyl estradiol-16-methyl carboxamide Drug Info [528033]
N-methyl estrone-16-methyl carboxamide Drug Info [528033]
N-methyl-N-ethyl estradiol-16-carboxamide Drug Info [528033]
N-methyl-N-ethyl estrone-16-methyl carboxamide Drug Info [528033]
N-N-diethyl estradiol-16-methyl carboxamide Drug Info [528033]
NARINGENIN Drug Info [529519]
Nicotinamide-Adenine-Dinucleotide Drug Info [551393]
NSC-94258 Drug Info [529519]
Agonist 4-Androstenedione Drug Info [551393]
Pathways
BioCyc Pathway Superpathway of steroid hormone biosynthesis
Estradiol biosynthesis I
KEGG Pathway Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
NetPath Pathway FSH Signaling Pathway
PANTHER Pathway Androgen/estrogene/progesterone biosynthesis
PathWhiz Pathway Androgen and Estrogen Metabolism
Reactome The canonical retinoid cycle in rods (twilight vision)
WikiPathways Steroid Biosynthesis
Metabolism of steroid hormones and vitamin D
Prostate Cancer
References
Ref 522980ClinicalTrials.gov (NCT01091077) A Pilot Study of the Grapefruit Flavonoid Naringenin for HCV Infection. U.S. National Institutes of Health.
Ref 528033J Med Chem. 2006 Feb 23;49(4):1325-45.Modification of estrone at the 6, 16, and 17 positions: novel potent inhibitors of 17beta-hydroxysteroid dehydrogenase type 1.
Ref 529359J Med Chem. 2008 Apr 10;51(7):2158-69. Epub 2008 Mar 7.Design, synthesis, and biological evaluation of (hydroxyphenyl)naphthalene and -quinoline derivatives: potent and selective nonsteroidal inhibitors of 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1) for the treatment of estrogen-dependent diseases.
Ref 529504Bioorg Med Chem. 2008 Jun 15;16(12):6423-35. Epub 2008 May 3.Design, synthesis and biological evaluation of bis(hydroxyphenyl) azoles as potent and selective non-steroidal inhibitors of 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1) for the treatment of estrogen-dependent diseases.
Ref 529519J Med Chem. 2008 Jul 24;51(14):4188-99. Epub 2008 Jun 6.Discovery of nonsteroidal 17beta-hydroxysteroid dehydrogenase 1 inhibitors by pharmacophore-based screening of virtual compound libraries.
Ref 529595J Med Chem. 2008 Aug 14;51(15):4685-98. Epub 2008 Jul 17.Substituted 6-phenyl-2-naphthols. Potent and selective nonsteroidal inhibitors of 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1): design, synthesis, biological evaluation, and pharmacokinetics.
Ref 529748J Med Chem. 2008 Nov 13;51(21):6725-39. Epub 2008 Oct 15.Design, synthesis, biological evaluation and pharmacokinetics of bis(hydroxyphenyl) substituted azoles, thiophenes, benzenes, and aza-benzenes as potent and selective nonsteroidal inhibitors of 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1).
Ref 530450J Med Chem. 2009 Nov 12;52(21):6724-43.New insights into the SAR and binding modes of bis(hydroxyphenyl)thiophenes and -benzenes: influence of additional substituents on 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1) inhibitory activity and selectivity.
Ref 530868Bioorg Med Chem. 2010 May 15;18(10):3494-505. Epub 2010 Mar 29.Novel estrone mimetics with high 17beta-HSD1 inhibitory activity.
Ref 551374The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.