TTD | Target: T20178

Target General Infomation
Target ID	T20178
Former ID	TTDS00131
Target Name	Tumor necrosis factor
Gene Name	TNF
Synonyms	Cachectin; TNF alpha; TNF-a; TNF-alpha; TNFalpha; Tumor necrosis factor ligand superfamily member 2; Tumor necrosis factor receptor 1; Tumour necrosis factor; Tumour necrosis factor alpha; TNF
Target Type	Successful
Disease	Asthma [ICD10: J45]
	Atopic dermatitis; Psoriatic disorder [ICD9:691.8, 692.9, 696; ICD10: L00-L99, L40]
	Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4]
	Autoimmune diabetes [ICD10: E08-E13]
	Arthritis [ICD9: 710-719; ICD10: M00-M25]
	Crohn's disease; Ulcerative colitis; Rheumatoid arthritis; Ankylosing spondylitis; Psoriatic arthritis; Plaque psoriasis [ICD10: K50.0, K51.90, M05.9, M45.3, L40.52, L40]
	Crohn's disease [ICD9: 555; ICD10: K50]
	Colitis [ICD9: 556.9; ICD10: K50-K52]
	Diarrhea [ICD9: 787.91; ICD10: A09, K59.1]
	Esophageal cancer [ICD9: 150; ICD10: C15]
	Heart transplant rejection [ICD9: 996; ICD10: T86]
	Intermittent claudication [ICD9: 440.21; ICD10: I73.9]
	Inflammatory bowel disease [ICD9: 555, 556; ICD10: K50, K51]
	Multiple myeloma [ICD9: 203; ICD10: C90]
	Multiple myeloma; Anaemia [ICD9:203, 280-285, 585.9585.1-585.5403; ICD10: C90, D50-D64, N18]
	Motor neurone disease; Amyotropic lateral sclerosis [ICD9: 335.2; ICD10: G12.2]
	Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0]
	Ocular disease [ICD10: H00-H59]
	Osteoarthritis [ICD9: 715; ICD10: M15-M19, M47]
	Pemphigus vulgaris; Vasculitis; Wegener's granulomatosis [ICD10: C91-C95, J45, J84.1, L80, M081, M45, M35.0, M40-M54, T86.0]
	Pneumonia [ICD10: J12-J18]
	Psoriatic disorder [ICD9: 696; ICD10: L40]
	Psoriasis [ICD9: 696; ICD10: L40]
	Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06]
	Rheumatoid arthritis; Dermatomyositis; Polymyositis; Juvenile rheumatoid arthritis; Graft-versus-host disease; Esophagitis [ICD10: K20, L40, M05-M06, M08.0, T86.0]
	Rheumatoid arthritis; Psoriasis [ICD9: 696, 710-719, 714; ICD10: L40, M00-M25, M05-M06]
	Rheumatold arthritis; Psoriatic arthritis; Ankylosing spondylitis [ICD9: 696.0, 710-719, 714, 720.0; ICD10: L40.5, M00-M25, M05-M06, M07, M08.1, M45]
	Sciatica [ICD10: M54.3-M54.4]
	Sepsis [ICD9: 995.91; ICD10: A40, A41]
	Solid tumours [ICD9: 140-199, 210-229; ICD10: C00-D48]
	Unspecified [ICD code not available]
Function	The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
BioChemical Class	Cytokine: tumor necrosis factor
Target Validation	T20178
UniProt ID	P01375
Sequence	MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Drugs and Mode of Action
Drug(s)	Adalimumab	Drug Info	Approved	Rheumatoid arthritis	[1], [2]
	Certolizumab	Drug Info	Approved	Rheumatoid arthritis	[3]
	Certolizumab pegol	Drug Info	Approved	Unspecified	[4]
	Enbrel	Drug Info	Approved	Active rheumatoid arthritis	[5]
	Etanercept	Drug Info	Approved	Active rheumatoid arthritis	[6]
	Golimumab	Drug Info	Approved	Rheumatold arthritis; Psoriatic arthritis; Ankylosing spondylitis	[7], [8], [9]
	Infliximab	Drug Info	Approved	Crohn's disease; Ulcerative colitis; Rheumatoid arthritis; Ankylosing spondylitis; Psoriatic arthritis; Plaque psoriasis	[10], [11], [12]
	Lenalidomide	Drug Info	Approved	Multiple myeloma; Anaemia	[13], [14], [15], [4]
	Pentoxifylline	Drug Info	Approved	Intermittent claudication	[16], [17]
	Thalidomide	Drug Info	Approved	Multiple myeloma	[18], [19]
	ABP 501	Drug Info	Phase 3	Rheumatoid arthritis	[20]
	Etanercept	Drug Info	Phase 3	Sciatica	[21], [22]
	Golnerminogene pradenovac	Drug Info	Phase 3	Esophageal cancer	[23]
	Infliximab	Drug Info	Phase 3	Asthma	[10], [2]
	Golimumab	Drug Info	Phase 2/3	Inflammatory bowel disease	[8], [9]
	ABT-122	Drug Info	Phase 2	Rheumatoid arthritis	[24], [25]
	AN0128	Drug Info	Phase 2	Atopic dermatitis; Psoriatic disorder	[26]
	AP-301-IH	Drug Info	Phase 2	Pneumonia	[27]
	DLX-105	Drug Info	Phase 2	Osteoarthritis	[28]
	ESBA-105	Drug Info	Phase 2	Ocular disease	[29]
	Etanercept	Drug Info	Phase 2	Pemphigus vulgaris; Vasculitis; Wegener's granulomatosis	[30], [31], [32], [33], [34], [35], [36], [37], [38], [39], [40], [41], [42], [43], [44], [45], [46], [47]
	Infliximab	Drug Info	Phase 2	Rheumatoid arthritis; Dermatomyositis; Polymyositis; Juvenile rheumatoid arthritis; Graft-versus-host disease; Esophagitis	[48], [49], [50], [51], [52], [53], [54], [55], [56], [57]
	IP-751	Drug Info	Phase 2	Neuropathic pain	[58]
	Pegsunercept	Drug Info	Phase 2	Rheumatoid arthritis	[59]
	RDP58	Drug Info	Phase 2	Diarrhea	[60]
	TNF alpha kinoid	Drug Info	Phase 2	Autoimmune diabetes	[61]
	COVA322	Drug Info	Phase 1/2a	Psoriasis	[62]
	ART621	Drug Info	Phase 1/2	Rheumatoid arthritis; Psoriasis	[63]
	CYT-609	Drug Info	Phase 1	Solid tumours	[64]
	PF-05230905	Drug Info	Phase 1	Rheumatoid arthritis	[65]
	PF-06410293	Drug Info	Phase 1	Rheumatoid arthritis	[66]
	PF-06438179	Drug Info	Phase 1	Rheumatoid arthritis	[67]
	PMI-005	Drug Info	Phase 1	Osteoarthritis	[68]
	ABX-0401	Drug Info	Preclinical	Inflammatory bowel disease	[69]
	Celastrol	Drug Info	Preclinical	Motor neurone disease; Amyotropic lateral sclerosis	[70]
	Genz29155	Drug Info	Preclinical	Heart transplant rejection	[71]
	CDP571	Drug Info	Discontinued in Phase 3	Crohn's disease	[72]
	Segard	Drug Info	Discontinued in Phase 3	Sepsis	[73]
	Camobucol	Drug Info	Discontinued in Phase 2	Rheumatoid arthritis	[74]
	CRx-191	Drug Info	Discontinued in Phase 2	Psoriatic disorder	[75]
	CytoFab	Drug Info	Discontinued in Phase 2	Sepsis	[76]
	AME-527	Drug Info	Discontinued in Phase 1/2	Rheumatoid arthritis	[77]
	CYT-007-TNFQb	Drug Info	Discontinued in Phase 1/2	Allergic rhinitis	[78]
	ALS-00T2-0501	Drug Info	Discontinued in Phase 1	Psoriasis	[79]
	FR-133605	Drug Info	Terminated	Arthritis	[80]
	MDL-201112	Drug Info	Terminated	Colitis	[81]
	TNFQb therapeutic vaccines	Drug Info	Terminated	Crohn's disease	[82]
Modulator	ABT-122			Drug Info
	ALS-00T2-0501			Drug Info	[83]
	CDP571			Drug Info
	Certolizumab pegol			Drug Info	[84]
	COVA322			Drug Info	[85]
	CYT-609			Drug Info	[86]
	DOM-0215			Drug Info	[87]
	Enbrel			Drug Info
	Etanercept			Drug Info	[88]
	FR-133605			Drug Info	[80]
	Golnerminogene pradenovac			Drug Info	[89]
Inhibitor	ABX-0401			Drug Info	[90]
	AN0128			Drug Info	[91], [92], [93]
	AP-301-IH			Drug Info	[94]
	ART621			Drug Info	[63]
	BAICALEIN			Drug Info	[95]
	Camobucol			Drug Info	[96]
	Certolizumab			Drug Info	[3]
	CRx-191			Drug Info	[97]
	CYT-007-TNFQb			Drug Info	[98]
	Genz29155			Drug Info	[71]
	IK-682			Drug Info	[99]
	IP-751			Drug Info	[58]
	Isopropyl Alcohol			Drug Info	[100]
	Lenalidomide			Drug Info	[101], [102]
	MDL-201112			Drug Info	[103]
	Pegsunercept			Drug Info	[104]
	PF-05230905			Drug Info	[105]
	PF-06438179			Drug Info	[106]
	PKF-241-466			Drug Info	[107]
	PKF-242-484			Drug Info	[107]
	PMI-005			Drug Info	[108]
	RDP58			Drug Info	[60]
	Thalidomide			Drug Info	[109]
	Y-39041			Drug Info	[110]
Suppressor	Celastrol			Drug Info	[70]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP	EXP Info
Pathways
KEGG Pathway	MAPK signaling pathway
	Cytokine-cytokine receptor interaction
	NF-kappa B signaling pathway
	Sphingolipid signaling pathway
	mTOR signaling pathway
	Apoptosis
	TGF-beta signaling pathway
	Osteoclast differentiation
	Antigen processing and presentation
	Toll-like receptor signaling pathway
	NOD-like receptor signaling pathway
	RIG-I-like receptor signaling pathway
	Hematopoietic cell lineage
	Natural killer cell mediated cytotoxicity
	T cell receptor signaling pathway
	Fc epsilon RI signaling pathway
	TNF signaling pathway
	Adipocytokine signaling pathway
	Type II diabetes mellitus
	Non-alcoholic fatty liver disease (NAFLD)
	Type I diabetes mellitus
	Alzheimer&#039
	s disease
	Amyotrophic lateral sclerosis (ALS)
	Pertussis
	Legionellosis
	Leishmaniasis
	Chagas disease (American trypanosomiasis)
	African trypanosomiasis
	Malaria
	Toxoplasmosis
	Amoebiasis
	Tuberculosis
	Hepatitis C
	Hepatitis B
	Influenza A
	HTLV-I infection
	Herpes simplex infection
	Proteoglycans in cancer
	Asthma
	Inflammatory bowel disease (IBD)
	Systemic lupus erythematosus
	Rheumatoid arthritis
	Allograft rejection
	Graft-versus-host disease
	Hypertrophic cardiomyopathy (HCM)
	Dilated cardiomyopathy
NetPath Pathway	TCR Signaling Pathway
	IL2 Signaling Pathway
	IL3 Signaling Pathway
	IL4 Signaling Pathway
	Leptin Signaling Pathway
	RANKL Signaling Pathway
	IL1 Signaling Pathway
PANTHER Pathway	Apoptosis signaling pathway
PANTHER Pathway	Wnt signaling pathway
Pathway Interaction Database	IL27-mediated signaling events
	Canonical NF-kappaB pathway
	Calcineurin-regulated NFAT-dependent transcription in lymphocytes
	Angiopoietin receptor Tie2-mediated signaling
	Signaling events mediated by HDAC Class I
	TNF receptor signaling pathway
	Ceramide signaling pathway
	amb2 Integrin signaling
	RXR and RAR heterodimerization with other nuclear receptor
	IL23-mediated signaling events
	Negative effector of Fas and TNF-alpha
	Caspase Cascade in Apoptosis
	Cellular roles of Anthrax toxin
	Downstream signaling in na&amp
	#xef
	ve CD8+ T cells
PathWhiz Pathway	Fc Epsilon Receptor I Signaling in Mast Cells
Reactome	Transcriptional regulation of white adipocyte differentiation
	TNFR1-induced proapoptotic signaling
	Regulation of TNFR1 signaling
	TNFR1-induced NFkappaB signaling pathway
	TNFR1-mediated ceramide production
	TNFR2 non-canonical NF-kB pathway
	TNF signaling
WikiPathways	Toll-like receptor signaling pathway
	Monoamine Transport
	SIDS Susceptibility Pathways
	TGF Beta Signaling Pathway
	Cytokines and Inflammatory Response
	MAPK Signaling Pathway
	EV release from cardiac cells and their functional effects
	FAS pathway and Stress induction of HSP regulation
	Apoptosis-related network due to altered Notch3 in ovarian cancer
	Cardiac Hypertrophic Response
	Transcriptional Regulation of White Adipocyte Differentiation
	Aryl Hydrocarbon Receptor
	Apoptosis
	Nanoparticle triggered regulated necrosis
	Amyotrophic lateral sclerosis (ALS)
	Adipogenesis
	Allograft Rejection
	TNF alpha Signaling Pathway
	TWEAK Signaling Pathway
	Extrinsic Pathway for Apoptosis
	Folate Metabolism
	MicroRNAs in cardiomyocyte hypertrophy
	Vitamin B12 Metabolism
	Selenium Micronutrient Network
	Regulation of toll-like receptor signaling pathway
	Matrix Metalloproteinases
References
REF 1	(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4860).
REF 2	Molecular targets of rheumatoid arthritis. Inflamm Allergy Drug Targets. 2008 Mar;7(1):53-66.
REF 3	Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96.
REF 4	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
REF 5	Oral pentoxifylline inhibits release of tumor necrosis factor-alpha from human peripheral blood monocytes : a potential treatment for aseptic loosening of total joint components.
REF 6	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
REF 7	Golimumab: a tumor necrosis factor alpha inhibitor for the treatment of rheumatoid arthritis. Ann Pharmacother. 2010 Jan;44(1):135-44.
REF 8	Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
REF 9	(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6776).
REF 10	(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5004).
REF 11	Drug insight: tumor necrosis factor-converting enzyme as a pharmaceutical target for rheumatoid arthritis. Nat Clin Pract Rheumatol. 2008 Jun;4(6):300-9. Epub 2008 Apr 15.
REF 12	Drugs@FDA (Edaravone)
REF 13	Emerging therapies for multiple myeloma. Expert Opin Emerg Drugs. 2009 Mar;14(1):99-127.
REF 14	(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7331).
REF 15	2005 approvals: Safety first. Nature Reviews Drug Discovery 5, 92-93 (February 2006).
REF 16	New drugs in development for the treatment of endometriosis. Expert Opin Investig Drugs. 2008 Aug;17(8):1187-202.
REF 17	(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7095).
REF 18	Thalidomide in multiple myeloma--clinical trials and aspects of drug metabolism and toxicity. Expert Opin Drug Metab Toxicol. 2008 Jul;4(7):973-85.
REF 19	(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7327).
REF 20	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800038738)
REF 21	Etanercept, a TNF antagonist for treatment for psoriatic arthritis and psoriasis. Skin Therapy Lett. 2003 Jan;8(1):1-4.
REF 22	(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6789).
REF 23	ClinicalTrials.gov (NCT00051467) A Study of TNFerade Biologic With 5-FU and Radiation Therapy for First-Line Treatment of Unresectable Locally Advanced Pancreatic Cancer. U.S. National Institutes of Health.
REF 24	ClinicalTrials.gov (NCT02349451) A Phase 2 Study to Investigate the Safety, Tolerability and Efficacy of ABT-122 in Subjects With Active Psoriatic Arthritis Who Have an Inadequate Response to Methotrexate. U.S. National Institutes of Health.
REF 25	ClinicalTrials.gov (NCT02433340) Phase 2, Multicenter, Open-Label Extension (OLE) Study With ABT-122 in Rheumatoid Arthritis Subjects Who Have Completed the Preceding M12-963 Study
REF 26	Clinical pipeline report, company report or official report of Anacor Pharmaceuticals.
REF 27	ClinicalTrials.gov (NCT02095626) Study in Intensive Care Patients Regarding the Effect of Inhaled AP-301 After Primary Graft Dysfunction After Lung Transplantation. U.S. National Institutes of Health.
REF 28	ClinicalTrials.gov (NCT01624376) Randomized, Double-blind, Placebo-controlled Study in Patients With Fistulizing Crohn's Disease. U.S. National Institutes of Health.
REF 29	ClinicalTrials.gov (NCT00823173) Exploratory Study on Topical ESBA105 in Acute Anterior Uveitis. U.S. National Institutes of Health.
REF 30	ClinicalTrials.gov (NCT00001901) Etanercept to Treat Wegener's Granulomatosis
REF 31	ClinicalTrials.gov (NCT00001954) Etanercept Therapy for Sjogren's Syndrome
REF 32	ClinicalTrials.gov (NCT00005007) Etanercept for Wegener's Granulomatosis
REF 33	ClinicalTrials.gov (NCT00006070) Etanercept (Enbrel) to Treat Pain and Swelling After Third Molar Extraction
REF 34	ClinicalTrials.gov (NCT00034060) The Role of Cytokines on Growth Hormone Suppression in Premenopausal Women With Rheumatoid Arthritis and the Effect of Treatment With Etanercept
REF 35	ClinicalTrials.gov (NCT00063869) Study Evaluating the Safety and Efficacy of Etanercept in Patients With Idiopathic Pulmonary Fibrosis
REF 36	ClinicalTrials.gov (NCT00107991) Etanercept for Treatment of Hidradenitis
REF 37	ClinicalTrials.gov (NCT00134368) Study of the Efficacy and Safety of Etanercept in Adults With Vitiligo
REF 38	ClinicalTrials.gov (NCT00135720) Study of Etanercept (Enbrel) in the Treatment of Pemphigus Vulgaris
REF 39	ClinicalTrials.gov (NCT00141713) The Use of Etanercept (Enbrel) in the Treatment of Acute Graft-Versus-Host Disease
REF 40	ClinicalTrials.gov (NCT00141726) Study of Enbrel (Etanercept) for the Treatment Sub-Acute Pulmonary Dysfunction After Allogeneic Stem Cell Transplant
REF 41	ClinicalTrials.gov (NCT00141739) Study of Etanercept for the Prevention of Complications Resulting From Hematopoietic Stem Cell Transplantation (HSCT)
REF 42	ClinicalTrials.gov (NCT00141791) Study Evaluating Etanercept in Moderate to Severe Asthma
REF 43	ClinicalTrials.gov (NCT00509600) Etanercept (Enbrel) for Juvenile Myelomonocytic Leukemia
REF 44	ClinicalTrials.gov (NCT01289730) Etanercept (Enbrel) in Undifferentiated Spondyloarthritis
REF 45	ClinicalTrials.gov (NCT01289743) Etanercept (Enbrel) in Ankylosing Spondylitis
REF 46	ClinicalTrials.gov (NCT01730495) Tumor Necrosis Factor-alpha Inhibition Using Etanercept in Chronic Fatigue Syndrome
REF 47	ClinicalTrials.gov (NCT02656082) Targeted Therapy Using Intradermal Injection of Etanercept for Remission Induction in Discoid Lupus Erythematosus
REF 48	ClinicalTrials.gov (NCT00006292) Infliximab for the Treatment of Early Rheumatoid Arthritis
REF 49	ClinicalTrials.gov (NCT00029042) Infliximab to Treat Children With Juvenile Rheumatoid Arthritis
REF 50	ClinicalTrials.gov (NCT00033891) Infliximab (Remicade ) to Treat Dermatomyositis and Polymyositis
REF 51	ClinicalTrials.gov (NCT00076726) A Study of the Safety and Effectiveness of Infliximab (Remicade) in Patients With Giant Cell Arteritis
REF 52	ClinicalTrials.gov (NCT00201799) Infliximab for the Prevention of Graft-versus-Host Disease Following Allogenic Hematopoietic Stem Cell Transplantation
REF 53	ClinicalTrials.gov (NCT00230529) A Safety and Efficacy Study of Infliximab (Remicade) in Patients With Plaque Type Psoriasis
REF 54	ClinicalTrials.gov (NCT00244192) Effects of Infliximab (Remicade) on Fat Free Mass in Patients With Moderate to Severe COPD Suffering From Cachexia
REF 55	ClinicalTrials.gov (NCT00443222) Treatment With TNF Blockade, Infliximab, in Patients With Myositis
REF 56	ClinicalTrials.gov (NCT00523354) Off Label Use of Infliximab in Adult Patients With Severe Eosinophilic Esophagitis
REF 57	ClinicalTrials.gov (NCT00823641) The HAM Infliximab Study
REF 58	Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
REF 59	ClinicalTrials.gov (NCT00537667) The SPECTRA Study. U.S. National Institutes of Health.
REF 60	RDP58, a locally active TNF inhibitor, is effective in the dextran sulphate mouse model of chronic colitis. Inflamm Res. 2002 Nov;51(11):522-31.
REF 61	ClinicalTrials.gov (NCT01911234) Clinical Efficacy of TNF-Kinoid in Patients With Rheumatoid Arthritis. U.S. National Institutes of Health.
REF 62	ClinicalTrials.gov (NCT02243787) Safety and Tolerability Study of COVA322 in Patients With Stable Chronic Moderate-to-severe Plaque Psoriasis
REF 63	Emerging drugs for psoriasis. Expert Opin Emerg Drugs. 2009 Mar;14(1):145-63.
REF 64	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025369)
REF 65	ClinicalTrials.gov (NCT01284036) A Single Dose Study Of The Safety And Investigational Product Level Measurement In Healthy Subjects. U.S. National Institutes of Health.
REF 66	ClinicalTrials.gov (NCT02572245) A Study of PF-06410293 Following Subcutaneous Administration Using A Prefilled Syringe Or A Prefilled Pen In Healthy Adult Subjects.
REF 67	ClinicalTrials.gov (NCT01844804) A Pharmacokinetics Study Comparing PF-06438179 and Infliximab in Healthy Volunteers (REFLECTIONS B537-01). U.S. National Institutes of Health.
REF 68	ClinicalTrials.gov (NCT01010919) A Study of Chicory for Treatment of Osteoarthritis of the Hip or Knee. U.S. National Institutes of Health.
REF 69	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020354)
REF 70	Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52.
REF 71	New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21.
REF 72	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003884)
REF 73	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002771)
REF 74	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015375)
REF 75	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025635)
REF 76	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006437)
REF 77	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019215)
REF 78	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021664)
REF 79	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023971)
REF 80	Effect of FR133605, a novel cytokine suppressive agent, on bone and cartilage destruction in adjuvant arthritic rats. J Rheumatol. 1996 Oct;23(10):1778-83.
REF 81	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007330)
REF 82	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034853)
REF 83	Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
REF 84	Population pharmacokinetic analysis of certolizumab pegol in patients with Crohn's disease. J Clin Pharmacol. 2015 Aug;55(8):866-74.
REF 85	Bispecific antibodies rise again. Nat Rev Drug Discov. 2014 Nov;13(11):799-801. doi: 10.1038/nrd4478.
REF 86	Phase I and Pharmacokinetic Studies of CYT-6091, a Novel PEGylated Colloidal Gold-rhTNF Nanomedicine. Clin Cancer Res. 2010 December 15; 16(24): 6139-6149.
REF 87	The ChEMBL database in 2017.
REF 88	The potential of biologics for the treatment of asthma. Nat Rev Drug Discov. 2012 Dec;11(12):958-72. doi: 10.1038/nrd3792.
REF 89	TNFerade, an adenovector carrying the transgene for human tumor necrosis factor alpha, for patients with advanced solid tumors: surgical experience and long-term follow-up. Ann Surg Oncol. 2005 Oct;12(10):825-30. Epub 2005 Aug 9.
REF 90	US patent application no. 8007,790, Methods for treating polycystic kidney disease (pkd) or other cyst forming diseases.
REF 91	Identification of a novel boron-containing antibacterial agent (AN0128) with anti-inflammatory activity, for the potential treatment of cutaneous diseases. Bioorg Med Chem Lett. 2006 Dec 1;16(23):5963-7. Epub 2006 Sep 25.
REF 92	Inhibition of experimental periodontitis by a topical boron-based antimicrobial. J Dent Res. 2008 Feb;87(2):148-52.
REF 93	Anacor Announces Positive Results From Phase 2 Trial Of Novel Anti-Inflammatory Agent For The Treatment Of Atopic Dermatitis. Anacor Pharmaceuticals. Friday 16 June 2006.
REF 94	AP301, a synthetic peptide mimicking the lectin-like domain of TNF, enhances amiloride-sensitive Na(+) current in primary dog, pig and rat alveolar type II cells. Pulm Pharmacol Ther. 2013 Jun;26(3):356-63.
REF 95	Bioorg Med Chem Lett. 2010 Nov 1;20(21):6195-8. Epub 2010 Sep 16.Discovery of the inhibitors of tumor necrosis factor alpha with structure-based virtual screening.
REF 96	AGIX-4207 [2-[4-[[1-[[3,5-bis(1,1-dimethylethyl)-4-hydroxyphenyl]thio]-1-methylethyl]thio]-2,6-bis(1,1-dimethylethyl)phenoxy]acetic acid], a novel antioxidant and anti-inflammatory compound: cellularand biochemical characterization of antioxidant activity and inhibition of redox-sensitive inflammatory gene expression. J Pharmacol Exp Ther. 2005 May;313(2):492-501. Epub 2005 Feb 8.
REF 97	CombinatoRx Drug Candidate CRx-191 Demonstrates Positive Phase 2 Results In Psoriasis. CombinatoRx. 2008.
REF 98	Therapeutic Vaccination with TNF-Kinoid in TNF Antagonist-Resistant Rheumatoid Arthritis: A Phase II Randomized, Controlled Clinical Trial. PLoS One. 2014; 9(12): e113465.
REF 99	J Med Chem. 2002 Nov 7;45(23):4954-7.Discovery of gamma-lactam hydroxamic acids as selective inhibitors of tumor necrosis factor alpha converting enzyme: design, synthesis, and structure-activity relationships.
REF 100	The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
REF 101	The thalidomide saga. Int J Biochem Cell Biol. 2007;39(7-8):1489-99. Epub 2007 Jan 30.
REF 102	Thalidomide and thalidomide analogues for maintenance of remission in Crohn's disease. Cochrane Database Syst Rev. 2009 Apr 15;(2):CD007351.
REF 103	Effect of the carbocyclic nucleoside analogue MDL 201,112 on inhibition of interferon-gamma-induced priming of Lewis (LEW/N) rat macrophages for enhanced respiratory burst and MHC class II Ia+ antigen expression. J Leukoc Biol. 1994 Aug;56(2):133-44.
REF 104	Diabetes-enhanced tumor necrosis factor-alpha production promotes apoptosis and the loss of retinal microvascular cells in type 1 and type 2 models of diabetic retinopathy. Am J Pathol. 2008 May;172(5):1411-8.
REF 105	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033173)
REF 106	Biosimilars in the therapy of inflammatory bowel diseases. Eur J Gastroenterol Hepatol. 2014 Jun;26(6):581-7.
REF 107	J Med Chem. 2002 May 23;45(11):2289-93.Beta-aryl-succinic acid hydroxamates as dual inhibitors of matrix metalloproteinases and tumor necrosis factor alpha converting enzyme.
REF 108	US patent application no. 2008,0269,123, Methods for treating polycystic kidney disease (pkd) or other cyst forming diseases.
REF 109	Efficacy of different thalidomide regimens for patients with multiple myeloma and its relationship with TNF-alpha level. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2008 Dec;16(6):1312-5.
REF 110	A novel anti-rheumatic drug suppresses tumor necrosis factor-alpha and augments interleukin-10 in adjuvant arthritic rats. Eur J Pharmacol. 2000 Dec 15;409(3):331-5.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Target Information

Prof. Feng ZHU

Prof. Yuzong CHEN