Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T83793
(Former ID: TTDR00778)
|
|||||
| Target Name |
Human immunodeficiency virus Negative factor (HIV nef)
|
|||||
| Synonyms |
nef; Nef protein; F-protein; 3'ORF; 27 kDa protein
Click to Show/Hide
|
|||||
| Gene Name |
HIV nef
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Human immunodeficiency virus disease [ICD-11: 1C60-1C62] | |||||
| Function |
Extracellular Nef protein targets CD4(+) T-lymphocytes for apoptosis by interacting with CXCR4 surface receptors.
Click to Show/Hide
|
|||||
| BioChemical Class |
Lentivirus primate group Nef
|
|||||
| UniProt ID | ||||||
| Sequence |
MGGKWSKRSMGGWSAIRERMRRAEPRAEPAADGVGAVSRDLEKHGAITSSNTAATNADCA
WLEAQEEEEVGFPVRPQVPLRPMTYKAALDISHFLKEKGGLEGLIWSQRRQEILDLWIYH TQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPVEPEKVEEANEGENNSLLHPMSLHGMEDA EKEVLVWRFDSKLAFHHMARELHPEYYKDC Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 4 Clinical Trial Drugs | + | ||||
| 1 | F4co vaccine | Drug Info | Phase 2 | Human immunodeficiency virus infection | [2], [3] | |
| 2 | LIPO-5 | Drug Info | Phase 2 | Human immunodeficiency virus infection | [4] | |
| 3 | Ad35-GRIN | Drug Info | Phase 1/2 | Human immunodeficiency virus infection | [5] | |
| 4 | Ad35-GRIN/ENV | Drug Info | Phase 1 | Human immunodeficiency virus infection | [6] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | GSK-732461 | Drug Info | Discontinued in Phase 2 | Human immunodeficiency virus infection | [3] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | MYRISTIC ACID | Drug Info | [10] | |||
| Drug Binding Sites of Target | Top | |||||
|---|---|---|---|---|---|---|
| Ligand Name: B-Octylglucoside | Ligand Info | |||||
| Structure Description | A novel HIV-1 Nef dimer interface induced by a single octyl-glucoside molecule | PDB:6B72 | ||||
| Method | X-ray diffraction | Resolution | 3.20 Å | Mutation | No | [11] |
| PDB Sequence |
ADCAWLEAQE
62 EEEVGFPVRP72 QVPLRPMTYK82 AALDISHFLK92 EKGGLEGLIW102 SQRRQEILDL 112 WIYHTQGYFP122 DWQNYTPGPG132 IRYPLTFGWC142 FKLVPVEEKE179 VLVWRFDSKL 189 AFHHMARELH199 PEYY
|
|||||
|
|
||||||
| Click to View More Binding Site Information of This Target with Different Ligands | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Drug Resistance Mutation (DRM) | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | EP patent application no. 2621528, Vaccine. | |||||
| REF 2 | ClinicalTrials.gov (NCT01218113) Efficacy and Safety of GSK Biologicals HIV Vaccine in Antiretroviral Therapy (ART)-naive HIV-1 Infected Persons. U.S. National Institutes of Health. | |||||
| REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027409) | |||||
| REF 4 | ClinicalTrials.gov (NCT01492985) Lipopeptide Immunisation With GTU-multiHIV Trial. U.S. National Institutes of Health. | |||||
| REF 5 | ClinicalTrials.gov (NCT02099994) Safety & Immunogenicity of HIV Vaccines in Healthy Kenyan Adults. U.S. National Institutes of Health. | |||||
| REF 6 | ClinicalTrials.gov (NCT01496989) Safety and Immunogenicity Study of HIV-MAG Vaccine +/- IL-12 and Ad35-GRIN/ENV in HIV-uninfected Volunteers. U.S. National Institutes of Health. | |||||
| REF 7 | HIV specific responses induced in nonhuman primates with ANRS HIV-Lipo-5 vaccine combined with rMVA-HIV prime or boost immunizations. Vaccine. 2015 May 11;33(20):2354-9. | |||||
| REF 8 | A phase I double blind, placebo-controlled, randomized study of a multigenic HIV-1 adenovirus subtype 35 vector vaccine in healthy uninfected adults. PLoS One. 2012;7(8):e41936. | |||||
| REF 9 | Preventive technologies, research toward a cure, and immune-based and gene therapies. HIV Treatment Bulletin. 30 June 2013. | |||||
| REF 10 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | |||||
| REF 11 | A single Beta-octyl glucoside molecule induces HIV-1 Nef dimer formation in the absence of partner protein binding. PLoS One. 2018 Feb 7;13(2):e0192512. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.