Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T32060
(Former ID: TTDS00103)
|
|||||
Target Name |
5-HT 2A receptor (HTR2A)
|
|||||
Synonyms |
Serotonin receptor 2A; HTR2; 5-hydroxytryptamine receptor 2A; 5-HT-2A; 5-HT-2
Click to Show/Hide
|
|||||
Gene Name |
HTR2A
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 7 Target-related Diseases | + | ||||
1 | Acute diabete complication [ICD-11: 5A2Y] | |||||
2 | Anxiety disorder [ICD-11: 6B00-6B0Z] | |||||
3 | Cerebral ischaemia [ICD-11: 8B1Z] | |||||
4 | Mood disorder [ICD-11: 6A60-6E23] | |||||
5 | Parkinsonism [ICD-11: 8A00] | |||||
6 | Pituitary gland disorder [ICD-11: 5A60-5A61] | |||||
7 | Schizophrenia [ICD-11: 6A20] | |||||
Function |
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores. Affects neural activity, perception, cognition and mood. Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A00273 ; BADD_A02979 ; BADD_A04075 | |||||
HIT2.0 ID | T64BED |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 9 Approved Drugs | + | ||||
1 | Aniracetam | Drug Info | Approved | Cerebrovascular ischaemia | [2], [3] | |
2 | Flibanserin | Drug Info | Approved | Mood disorder | [4], [5] | |
3 | Iloperidone | Drug Info | Approved | Schizophrenia | [6], [7] | |
4 | lumateperone tosylate | Drug Info | Approved | Schizophrenia | [8] | |
5 | Lurasidone hydrochloride | Drug Info | Approved | Schizophrenia | [9], [10], [11], [12] | |
6 | Metergolin | Drug Info | Approved | Hyperprolactinaemia | [12] | |
7 | Pimavanserin | Drug Info | Approved | Parkinson disease | [13] | |
8 | Sarpogrelate | Drug Info | Approved | Diabetic complication | [14], [15] | |
9 | ZOTEPINE | Drug Info | Approved | Anxiety disorder | [16], [12] | |
Clinical Trial Drug(s) | [+] 22 Clinical Trial Drugs | + | ||||
1 | Blonanserin | Drug Info | Phase 3 | Schizophrenia | [17], [18] | |
2 | ITI-007 | Drug Info | Phase 3 | Insomnia | [19], [20] | |
3 | M100907 | Drug Info | Phase 3 | Sleep-wake disorder | [21] | |
4 | MIN-101 | Drug Info | Phase 3 | Schizophrenia | [22] | |
5 | SR46349B | Drug Info | Phase 3 | Schizophrenia | [18] | |
6 | TNX-102 | Drug Info | Phase 3 | Fibromyalgia | [23] | |
7 | Zicronapine | Drug Info | Phase 3 | Schizophrenia | [24] | |
8 | BVT.28949 | Drug Info | Phase 2 | Glaucoma/ocular hypertension | [25] | |
9 | FKW00GA | Drug Info | Phase 2 | Social phobia | [26] | |
10 | NELOTANSERIN | Drug Info | Phase 2 | Lewy body dementia | [27] | |
11 | Nuplazid | Drug Info | Phase 2 | Alzheimer disease | [28] | |
12 | Ocaperidone | Drug Info | Phase 2 | Schizoaffective disorder | [29], [18], [30] | |
13 | PRUVANSERIN | Drug Info | Phase 2 | Sleep-wake disorder | [31] | |
14 | RP5063 | Drug Info | Phase 2 | Schizophrenia | [32] | |
15 | SYN120 | Drug Info | Phase 2 | Parkinson disease | [33] | |
16 | 1192U90 | Drug Info | Phase 1 | Psychotic disorder | [34] | |
17 | Abaperidone | Drug Info | Phase 1 | Schizophrenia | [35] | |
18 | ATI-9242 | Drug Info | Phase 1 | Schizophrenia | [26] | |
19 | DSP-1200 | Drug Info | Phase 1 | Depression | [26] | |
20 | SKL-10406 | Drug Info | Phase 1 | Major depressive disorder | [36] | |
21 | Temanogrel | Drug Info | Phase 1 | Cardiovascular disease | [37] | |
22 | YKP-1358 | Drug Info | Phase 1 | Schizoaffective disorder | [18] | |
Patented Agent(s) | [+] 3 Patented Agents | + | ||||
1 | PMID30124346-Compound-13TABLE4 | Drug Info | Patented | Attention deficit hyperactivity disorder | [38] | |
2 | PMID30124346-Compound-34TABLE4 | Drug Info | Patented | Attention deficit hyperactivity disorder | [38] | |
3 | PMID30124346-Compound-LDT8 | Drug Info | Patented | Benign prostatic hyperplasia | [38] | |
Discontinued Drug(s) | [+] 21 Discontinued Drugs | + | ||||
1 | LYSERGIC ACID DIETHYLAMIDE | Drug Info | Withdrawn from market | Addictive disorder | [39], [40] | |
2 | Deramciclane | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [41], [42] | |
3 | Iferanserin-Ventrus | Drug Info | Discontinued in Phase 3 | Hemorrhoids | [43] | |
4 | MDL-11939 | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [44], [45] | |
5 | Ritanserin | Drug Info | Discontinued in Phase 3 | Anxiety disorder | [46], [47] | |
6 | Adatanserin | Drug Info | Discontinued in Phase 2 | Mood disorder | [48] | |
7 | AMESERGIDE | Drug Info | Discontinued in Phase 2 | Mood disorder | [49], [50] | |
8 | FCE-22716 | Drug Info | Discontinued in Phase 2 | Hypertension | [51] | |
9 | SERAZAPINE HYDROCHLORIDE | Drug Info | Discontinued in Phase 2 | Anxiety disorder | [52] | |
10 | SERGOLEXOLE MALEATE | Drug Info | Discontinued in Phase 2 | Migraine | [53] | |
11 | SL65.0472 | Drug Info | Discontinued in Phase 2 | Cardiovascular disease | [54] | |
12 | YM-992 | Drug Info | Discontinued in Phase 2 | Depression | [55] | |
13 | AM-831 | Drug Info | Discontinued in Phase 1 | Schizophrenia | [56] | |
14 | DUP-734 | Drug Info | Discontinued in Phase 1 | Psychotic disorder | [57] | |
15 | AMPEROZIDE | Drug Info | Terminated | Alcohol dependence | [58] | |
16 | DV-7028 | Drug Info | Terminated | Cardiovascular disease | [59] | |
17 | Fananserin | Drug Info | Terminated | Schizophrenia | [60], [18] | |
18 | GMC-283 | Drug Info | Terminated | Schizophrenia | [18] | |
19 | ICI-169369 | Drug Info | Terminated | Anxiety disorder | [61], [62] | |
20 | R-102444 | Drug Info | Terminated | Pancreatitis | [63] | |
21 | ZD-3638 | Drug Info | Terminated | Schizophrenia | [18] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | Org-23366 | Drug Info | Preclinical | Schizophrenia | [18] | |
Mode of Action | [+] 7 Modes of Action | + | ||||
Inhibitor | [+] 191 Inhibitor drugs | + | ||||
1 | Aniracetam | Drug Info | [64] | |||
2 | ZOTEPINE | Drug Info | [69] | |||
3 | TRYPTAMINE | Drug Info | [75] | |||
4 | LYSERGIC ACID DIETHYLAMIDE | Drug Info | [88] | |||
5 | MDL-11939 | Drug Info | [93] | |||
6 | TIOSPIRONE | Drug Info | [97] | |||
7 | MAZAPERTINE | Drug Info | [100] | |||
8 | YM-992 | Drug Info | [104] | |||
9 | A-80426 | Drug Info | [107] | |||
10 | MDL-28161 | Drug Info | [93] | |||
11 | Ro-60-0175 | Drug Info | [120] | |||
12 | RP-68303 | Drug Info | [121] | |||
13 | (+/-)-nantenine | Drug Info | [122] | |||
14 | (1-Phenethyl-piperidin-4-yl)-phenyl-methanone | Drug Info | [69] | |||
15 | (2-Indol-1-yl-ethyl)-dimethyl-amine | Drug Info | [123] | |||
16 | (2S)-1-(1H-furo[2,3-g]indazol-1-yl)propan-2-amine | Drug Info | [120] | |||
17 | (2S)-1-(5-fluoro-1H-indazol-1-yl)propan-2-amine | Drug Info | [120] | |||
18 | (2S)-1-(6-fluoro-1H-indazol-1-yl)propan-2-amine | Drug Info | [120] | |||
19 | (2S)-1-(6-methoxy-1H-indazol-1-yl)propan-2-amine | Drug Info | [124] | |||
20 | (E)-2-(4-fluorostyryl)-5-(phenylsulfinyl)pyridine | Drug Info | [125] | |||
21 | (E)-2-(4-fluorostyryl)-5-(phenylsulfonyl)pyridine | Drug Info | [125] | |||
22 | (R)-(+)-(4,5,6-trimethoxyindan-1-yl)methanamine | Drug Info | [88] | |||
23 | (R)-(-)-11-hydroxy-N-n-propylnoraporphine | Drug Info | [126] | |||
24 | (R)-1-(4-iodo-2,5-dimethoxyphenyl)propan-2-amine | Drug Info | [127] | |||
25 | (R)-3-(4-propylmorpholin-2-yl)phenol | Drug Info | [128] | |||
26 | (R,S)-1-(5-bromo-1H-indol-1-yl)propan-2-amine | Drug Info | [129] | |||
27 | (R,S)-1-(5-chloro-1H-indol-1-yl)propan-2-amine | Drug Info | [129] | |||
28 | (R,S)-1-(5-fluoro-1H-indol-1-yl)propan-2-amine | Drug Info | [129] | |||
29 | (R,S)-1-(5-methyl-1H-indol-1-yl)propan-2-amine | Drug Info | [129] | |||
30 | (R,S)-1-(6-fluoro-1H-indol-1-yl)propan-2-amine | Drug Info | [129] | |||
31 | (S)-(-)-(4,5,6-trimethoxyindan-1-yl)methanamine | Drug Info | [88] | |||
32 | (S)-1-(5,6-difluoro-1H-indol-1-yl)propan-2-amine | Drug Info | [129] | |||
33 | 1,2,3,4-Tetrahydro-naphthalen-2-ylamine | Drug Info | [130] | |||
34 | 1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole | Drug Info | [123] | |||
35 | 1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane | Drug Info | [131] | |||
36 | 1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane | Drug Info | [131] | |||
37 | 1,6-bis(4-(pyridin-2-yl)piperazin-1-yl)hexane | Drug Info | [131] | |||
38 | 1,6-bis(4-m-tolylpiperazin-1-yl)hexane | Drug Info | [131] | |||
39 | 1,6-bis(4-phenylpiperazin-1-yl)hexane | Drug Info | [131] | |||
40 | 1-((R)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [124] | |||
41 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [124] | |||
42 | 1-((S)-2-aminopropyl)-7-chloro-1H-indazol-6-ol | Drug Info | [124] | |||
43 | 1-((S)-2-aminopropyl)-7-fluoro-1H-indazol-6-ol | Drug Info | [124] | |||
44 | 1-((S)-2-aminopropyl)-7-iodo-1H-indazol-6-ol | Drug Info | [124] | |||
45 | 1-((S)-2-aminopropyl)-7-methyl-1H-indazol-6-ol | Drug Info | [124] | |||
46 | 1-(10-Bromoanthracen-9-yl)-2-aminopropane | Drug Info | [132] | |||
47 | 1-(2,5-Dimethoxy-4-methyl-phenyl)-piperazine | Drug Info | [133] | |||
48 | 1-(2,5-Dimethoxy-phenyl)-piperazine | Drug Info | [133] | |||
49 | 1-(2,5-dimethoxyphenyl)propan-2-amine | Drug Info | [132] | |||
50 | 1-(2,6-dimethoxy-4-methylphenyl)propan-2-amine | Drug Info | [132] | |||
51 | 1-(2-aminoethyl)-1H-indazol-6-ol | Drug Info | [124] | |||
52 | 1-(2-Methoxy-phenyl)-4-propyl-piperazine | Drug Info | [134] | |||
53 | 1-(2-Methoxy-phenyl)-piperazine | Drug Info | [133] | |||
54 | 1-(3-(pentafluorosulfanyl)phenyl)propan-2-amine | Drug Info | [135] | |||
55 | 1-(3-(phenylthio)propyl)-4-m-tolylpiperazine | Drug Info | [136] | |||
56 | 1-(4-Bromo-2,5-difluorophenyl)-2-aminopropane | Drug Info | [132] | |||
57 | 1-(4-Bromo-2,5-dimethoxy-phenyl)-piperazine | Drug Info | [133] | |||
58 | 1-(4-ethyl-2,5-dimethoxyphenyl)propan-2-amine | Drug Info | [132] | |||
59 | 1-Butyl-3-(2-dimethylamino-ethyl)-1H-indol-4-ol | Drug Info | [137] | |||
60 | 1-Butyl-4-(2-methoxy-phenyl)-piperazine | Drug Info | [134] | |||
61 | 1-Ethyl-4-(2-methoxy-phenyl)-piperazine | Drug Info | [134] | |||
62 | 1-methoxy-9-aminomethyl-9,10-dihydroanthracene | Drug Info | [138] | |||
63 | 1-Methyl-1,3-dihydro-indol-2-one | Drug Info | [139] | |||
64 | 1-Naphthalen-2-yl-piperazine | Drug Info | [130] | |||
65 | 1-naphthylpiperazine | Drug Info | [130] | |||
66 | 1-Propyl-3-(3-trifluoromethyl-phenyl)-pyrrolidine | Drug Info | [140] | |||
67 | 11-Butyryloxy-N-n-propylnoraporphine | Drug Info | [126] | |||
68 | 11-Heptanoyloxy-N-n-propylnoraporphine | Drug Info | [126] | |||
69 | 11-Hexanoyloxy-N-n-propylnoraporphine | Drug Info | [126] | |||
70 | 11-Propionyloxy-N-n-propylnoraporphine | Drug Info | [126] | |||
71 | 11-valeryloxynoraporphine | Drug Info | [126] | |||
72 | 2,2-Diphenyl-ethylamine | Drug Info | [141] | |||
73 | 2,5-dimethoxy-4-bromophenethylamine | Drug Info | [142] | |||
74 | 2-(1H-indol-3-yl)-N,N-dimethylethanamine | Drug Info | [143], [132] | |||
75 | 2-(2-Amino-propyl)-5-bromo-4-methoxy-phenol | Drug Info | [144] | |||
76 | 2-(2-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [144] | |||
77 | 2-(3,5-dimethoxy-4-phenethoxyphenyl)ethanamine | Drug Info | [132] | |||
78 | 2-(3-Methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [144] | |||
79 | 2-(4-Bromo-2-methoxy-phenyl)-1-methyl-ethylamine | Drug Info | [144] | |||
80 | 2-(4-Bromo-phenyl)-1-methyl-ethylamine | Drug Info | [144] | |||
81 | 2-(4-Methyl-piperazin-1-yl)-4-phenyl-pyrimidine | Drug Info | [145] | |||
82 | 2-(5-Methoxy-1H-indol-3-yl)-1-methyl-ethylamine | Drug Info | [124] | |||
83 | 2-(9,10-dihydroanthracen-9-yl)-N-methylethanamine | Drug Info | [146] | |||
84 | 2-(piperazin-1-yl)-5,6,7,8-tetrahydroquinoline | Drug Info | [147] | |||
85 | 2-methoxy-9-aminomethyl-9,10-dihydroanthracene | Drug Info | [138] | |||
86 | 2-Phenyl-3-(2-piperidin-1-yl-ethyl)-1H-indole | Drug Info | [148] | |||
87 | 2-Phenyl-3-piperidin-4-yl-1H-indole | Drug Info | [148] | |||
88 | 2-Piperazin-1-yl-phenol | Drug Info | [133] | |||
89 | 3-(1-Benzyl-piperidin-4-yl)-2-phenyl-1H-indole | Drug Info | [148] | |||
90 | 3-(1-Methyl-piperidin-4-yl)-2-phenyl-1H-indole | Drug Info | [148] | |||
91 | 3-(1-Phenethyl-piperidin-4-yl)-2-phenyl-1H-indole | Drug Info | [148] | |||
92 | 3-(2-Amino-propyl)-1H-indol-5-ol | Drug Info | [124] | |||
93 | 3-(2-Dimethylamino-ethyl)-1-methyl-1H-indol-4-ol | Drug Info | [137] | |||
94 | 3-(2-Dimethylamino-ethyl)-1H-indol-6-ol | Drug Info | [137] | |||
95 | 3-(2-Dimethylamino-ethyl)-2-methyl-1H-indol-4-ol | Drug Info | [137] | |||
96 | 3-(2-Dimethylamino-propyl)-1H-indol-4-ol | Drug Info | [137] | |||
97 | 3-(2-Pyrrolidin-1-yl-ethyl)-1H-indol-4-ol | Drug Info | [137] | |||
98 | 3-(3-Dimethylamino-propyl)-1H-indol-4-ol | Drug Info | [137] | |||
99 | 3-Amino-1-(2-amino-5-methoxy-phenyl)-propan-1-one | Drug Info | [133] | |||
100 | 3-Dimethylaminomethyl-1-methyl-1H-indol-4-ol | Drug Info | [137] | |||
101 | 3-Dimethylaminomethyl-1H-indol-4-ol | Drug Info | [137] | |||
102 | 3-methoxy-9-aminomethyl-9,10-dihydroanthracene | Drug Info | [138] | |||
103 | 3-Naphthalen-1-yl-1-propyl-pyrrolidine | Drug Info | [140] | |||
104 | 3-Naphthalen-1-yl-pyrrolidine | Drug Info | [140] | |||
105 | 4,4-Diphenylbutan-1-amine | Drug Info | [146] | |||
106 | 4-(10H-Anthracen-9-ylidene)-1-methyl-piperidine | Drug Info | [141] | |||
107 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [149] | |||
108 | 4-(4-Fluoro-benzyl)-piperidine hydrochloride | Drug Info | [93] | |||
109 | 4-Benzyl-1-methyl-piperidine hydrochloride | Drug Info | [93] | |||
110 | 4-methoxy-9-aminomethyl-9,10-dihydroanthracene | Drug Info | [138] | |||
111 | 5,6-dichloro-3,4-dihydroquinazolin-2-amine | Drug Info | [150] | |||
112 | 5-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [151] | |||
113 | 5-chloro-3,4-dihydroquinazolin-2-amine | Drug Info | [150] | |||
114 | 5-chloro-N-(pyridin-3-yl)indoline-1-carboxamide | Drug Info | [129] | |||
115 | 5-MEO-DMT | Drug Info | [124] | |||
116 | 5-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [151] | |||
117 | 5-Methoxy-4,9-dihydro-3H-beta-carboline | Drug Info | [151] | |||
118 | 5-METHOXYTRYPTAMINE | Drug Info | [75] | |||
119 | 6,7-dichloro-2,3,4,5-tetrahydro-1H-3-benzazepine | Drug Info | [152] | |||
120 | 6-bromoaplysinopsin | Drug Info | [153] | |||
121 | 6-Chloro-1,2,3,4-tetrahydro-pyrazino[1,2-a]indole | Drug Info | [123] | |||
122 | 6-chloro-N-(pyridin-3-yl)indoline-1-carboxamide | Drug Info | [129] | |||
123 | 6-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [151] | |||
124 | 7,8,9,10-tetrahydro-6H-furo-[2,3-g][3]benzazepine | Drug Info | [152] | |||
125 | 7,8,9,10-tetrahydro-6H-furo-[3,2-g][3]benzazepine | Drug Info | [152] | |||
126 | 7-Chloro-1,2,3,4-tetrahydro-pyrazino[1,2-a]indole | Drug Info | [123] | |||
127 | 7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [151] | |||
128 | 8-Bromo-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [151] | |||
129 | 8-Bromo-4,9-dihydro-3H-beta-carboline | Drug Info | [151] | |||
130 | 8-Chloro-1,2,3,4-tetrahydro-pyrazino[1,2-a]indole | Drug Info | [123] | |||
131 | 8-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [151] | |||
132 | 8-Methoxy-2-(4-methyl-piperazin-1-yl)-quinoline | Drug Info | [130] | |||
133 | 8-Methoxy-2-piperazin-1-yl-quinoline | Drug Info | [130] | |||
134 | 8-Methoxy-4,9-dihydro-3H-beta-carboline | Drug Info | [151] | |||
135 | 9-(2-aminoethyl)-9,10-dihydroanthracene | Drug Info | [146] | |||
136 | 9-(2-aminopropyl)-9,10-dihydroanthracene | Drug Info | [146] | |||
137 | 9-(Aminomethyl)-9,10-dihydroanthracene | Drug Info | [141] | |||
138 | 9-(N-benzylaminomethyl)-9,10-dihydroanthracene | Drug Info | [154] | |||
139 | A-987306 | Drug Info | [156] | |||
140 | ALTANSERIN | Drug Info | [72] | |||
141 | Aplysinopsin | Drug Info | [129] | |||
142 | BARETTIN | Drug Info | [159] | |||
143 | Brolamfetamine | Drug Info | [161] | |||
144 | C-(5-bromo-4,7-dimethoxyindan-1-yl)methylamine | Drug Info | [142] | |||
145 | C-(5H-Dibenzo[a,d]cyclohepten-5-yl)-methylamine | Drug Info | [141] | |||
146 | C-(9H-Thioxanthen-9-yl)-methylamine | Drug Info | [141] | |||
147 | C-(9H-Xanthen-9-yl)-methylamine | Drug Info | [141] | |||
148 | CHLOROPHENYLPIPERAZINE | Drug Info | [163] | |||
149 | CINANSERIN | Drug Info | [75] | |||
150 | DOM | Drug Info | [132] | |||
151 | Etisulergine | Drug Info | [167] | |||
152 | FLUANISONE | Drug Info | [168] | |||
153 | ISOCLOZAPINE | Drug Info | [169] | |||
154 | LY433222 | Drug Info | [104] | |||
155 | MESCALINE | Drug Info | [132] | |||
156 | N,N-dimethyl-2,2-diphenylethanamine | Drug Info | [146] | |||
157 | N,N-Dimethyl-3,3-diphenylpropan-1-amine | Drug Info | [146] | |||
158 | N,N-dimethyl-4,4-diphenylbutan-1-amine | Drug Info | [146] | |||
159 | N-(1-(1-phenylethyl)piperidin-4-yl)-1-naphthamide | Drug Info | [177] | |||
160 | N-(1-(1-phenylethyl)piperidin-4-yl)-2-naphthamide | Drug Info | [177] | |||
161 | N-(1-(3-bromobenzyl)piperidin-4-yl)-1-naphthamide | Drug Info | [178] | |||
162 | N-(1-(3-bromobenzyl)piperidin-4-yl)-2-naphthamide | Drug Info | [178] | |||
163 | N-(1-(4-bromobenzyl)piperidin-4-yl)-2-naphthamide | Drug Info | [178] | |||
164 | N-(1-(4-nitrobenzyl)piperidin-4-yl)-2-naphthamide | Drug Info | [178] | |||
165 | N-(1-(4-phenylbutyl)piperidin-4-yl)-1-naphthamide | Drug Info | [177] | |||
166 | N-(1-(4-phenylbutyl)piperidin-4-yl)-2-naphthamide | Drug Info | [177] | |||
167 | N-(1-benzylpiperidine-4-yl)-2-naphthamide | Drug Info | [178] | |||
168 | N-(1-phenethylpiperidin-4-yl)-1-naphthamide | Drug Info | [177] | |||
169 | N-(1-phenethylpiperidin-4-yl)-2-naphthamide | Drug Info | [177] | |||
170 | N-3'-ethylaplysinopsin | Drug Info | [153] | |||
171 | N-methyl-3,3-diphenylpropan-1-amine | Drug Info | [146] | |||
172 | N-methyl-4,4-diphenylbutan-1-amine | Drug Info | [146] | |||
173 | PG-01037 | Drug Info | [180] | |||
174 | PHENETHYLAMINE | Drug Info | [141] | |||
175 | PHENYLPIPERAZINE | Drug Info | [130] | |||
176 | PSILOCIN | Drug Info | [132] | |||
177 | QUIPAZINE | Drug Info | [181] | |||
178 | Racemic DOI | Drug Info | [132] | |||
179 | Racemic DOTFM | Drug Info | [132] | |||
180 | SB-271046 | Drug Info | [185] | |||
181 | SEROTONIN | Drug Info | [181] | |||
182 | TRYPTOLINE | Drug Info | [151] | |||
183 | VER-2692 | Drug Info | [186] | |||
184 | VER-3323 | Drug Info | [187] | |||
185 | VER-5384 | Drug Info | [187] | |||
186 | VER-5593 | Drug Info | [187] | |||
187 | WAY-208466 | Drug Info | [188] | |||
188 | YM-348 | Drug Info | [152] | |||
189 | [2-(4-Fluoro-1H-indol-3-yl)-ethyl]-dimethyl-amine | Drug Info | [137] | |||
190 | [2-(6-Methoxy-indol-1-yl)-ethyl]-dimethyl-amine | Drug Info | [123] | |||
191 | [3H]spiperone | Drug Info | [192] | |||
Modulator | [+] 21 Modulator drugs | + | ||||
1 | Flibanserin | Drug Info | [5] | |||
2 | Lurasidone hydrochloride | Drug Info | [10], [11] | |||
3 | Pimavanserin | Drug Info | [13], [66] | |||
4 | SR46349B | Drug Info | [73] | |||
5 | Zicronapine | Drug Info | [76] | |||
6 | NELOTANSERIN | Drug Info | [78] | |||
7 | Ocaperidone | Drug Info | [30] | |||
8 | PRUVANSERIN | Drug Info | [80] | |||
9 | Abaperidone | Drug Info | [82] | |||
10 | ATI-9242 | Drug Info | [83], [30] | |||
11 | YKP-1358 | Drug Info | [86] | |||
12 | Deramciclane | Drug Info | [89], [90], [91] | |||
13 | Iferanserin-Ventrus | Drug Info | [92] | |||
14 | SL65.0472 | Drug Info | [103] | |||
15 | DUP-734 | Drug Info | [106] | |||
16 | AMPEROZIDE | Drug Info | [108] | |||
17 | ICI-169369 | Drug Info | [113] | |||
18 | R-102444 | Drug Info | [117], [118], [119] | |||
19 | EPLIVANSERIN MESILATE | Drug Info | [166] | |||
20 | SEL-73 | Drug Info | [30] | |||
21 | Very low dose (VLD) cyclobenzaprine | Drug Info | [30] | |||
Antagonist | [+] 70 Antagonist drugs | + | ||||
1 | Iloperidone | Drug Info | [7], [18] | |||
2 | lumateperone tosylate | Drug Info | [8] | |||
3 | Metergolin | Drug Info | [65] | |||
4 | Sarpogrelate | Drug Info | [1], [67], [68] | |||
5 | Blonanserin | Drug Info | [18] | |||
6 | ITI-007 | Drug Info | [70] | |||
7 | M100907 | Drug Info | [71], [72] | |||
8 | MIN-101 | Drug Info | [30] | |||
9 | TNX-102 | Drug Info | [74] | |||
10 | BVT.28949 | Drug Info | [77], [30] | |||
11 | FKW00GA | Drug Info | [26] | |||
12 | SYN120 | Drug Info | [81] | |||
13 | 1192U90 | Drug Info | [18] | |||
14 | DSP-1200 | Drug Info | [26] | |||
15 | 3-phenyl pyrazole derivative 1 | Drug Info | [87] | |||
16 | Benzoyl-piperidine derivative 1 | Drug Info | [87] | |||
17 | Benzoyl-piperidine derivative 2 | Drug Info | [87] | |||
18 | L-piperazino-3-phenyl-indane derivative 1 | Drug Info | [87] | |||
19 | Piperazine derivative 3 | Drug Info | [87] | |||
20 | Piperazine derivative 4 | Drug Info | [87] | |||
21 | PMID26609882-Compound-34 | Drug Info | [87] | |||
22 | PMID26609882-Compound-35 | Drug Info | [87] | |||
23 | PMID26609882-Compound-36 | Drug Info | [87] | |||
24 | PMID30124346-Compound-LDT8 | Drug Info | [38] | |||
25 | Pyrazole derivative 67 | Drug Info | [87] | |||
26 | Pyrazole derivative 68 | Drug Info | [87] | |||
27 | Pyrazole derivative 69 | Drug Info | [87] | |||
28 | Pyrazole derivative 70 | Drug Info | [87] | |||
29 | Pyrazole derivative 71 | Drug Info | [87] | |||
30 | Pyrazole derivative 72 | Drug Info | [87] | |||
31 | Pyrazole derivative 73 | Drug Info | [87] | |||
32 | Pyrazole derivative 74 | Drug Info | [87] | |||
33 | Pyrazole derivative 75 | Drug Info | [87] | |||
34 | Pyrimidine derivative 23 | Drug Info | [87] | |||
35 | Pyrimidine derivative 24 | Drug Info | [87] | |||
36 | Pyrimidine derivative 25 | Drug Info | [87] | |||
37 | Pyrimidine derivative 26 | Drug Info | [87] | |||
38 | Pyrimidine derivative 27 | Drug Info | [87] | |||
39 | Pyrimidine derivative 28 | Drug Info | [87] | |||
40 | Pyrimidine derivative 29 | Drug Info | [87] | |||
41 | Ritanserin | Drug Info | [94], [95], [96] | |||
42 | Adatanserin | Drug Info | [48], [98] | |||
43 | AMESERGIDE | Drug Info | [99], [30] | |||
44 | FCE-22716 | Drug Info | [51], [30] | |||
45 | SERAZAPINE HYDROCHLORIDE | Drug Info | [101], [30] | |||
46 | SERGOLEXOLE MALEATE | Drug Info | [102], [30] | |||
47 | Org-23366 | Drug Info | [18] | |||
48 | Fananserin | Drug Info | [112], [18] | |||
49 | GMC-283 | Drug Info | [18] | |||
50 | LY53857 | Drug Info | [96], [114], [115], [116] | |||
51 | 9-OH-risperidone | Drug Info | [155] | |||
52 | bufotenine | Drug Info | [162] | |||
53 | cyamemazine | Drug Info | [164] | |||
54 | EGIS-7625 | Drug Info | [165] | |||
55 | LY063518 | Drug Info | [171] | |||
56 | LY108742 | Drug Info | [172] | |||
57 | LY215840 | Drug Info | [172] | |||
58 | LY314228 | Drug Info | [171] | |||
59 | LY320954 | Drug Info | [171] | |||
60 | LY86057 | Drug Info | [172] | |||
61 | MPDT | Drug Info | [176] | |||
62 | norfluoxetine | Drug Info | [179] | |||
63 | SB 215505 | Drug Info | [182] | |||
64 | SB 221284 | Drug Info | [65] | |||
65 | SB 228357 | Drug Info | [183] | |||
66 | SB 242084 | Drug Info | [184] | |||
67 | spiramide | Drug Info | [65] | |||
68 | [11C]volinanserin | Drug Info | [189] | |||
69 | [18F]altanserin | Drug Info | [191] | |||
70 | [3H]N-methylspiperone | Drug Info | [158] | |||
Agonist | [+] 25 Agonist drugs | + | ||||
1 | Nuplazid | Drug Info | [79] | |||
2 | Temanogrel | Drug Info | [85], [30] | |||
3 | Aryl piperazine derivative 9 | Drug Info | [87] | |||
4 | Diarylamine and arylheteroarylamine pyrazole derivative 1 | Drug Info | [87] | |||
5 | Diarylamine and arylheteroarylamine pyrazole derivative 2 | Drug Info | [87] | |||
6 | Diarylamine and arylheteroarylamine pyrazole derivative 3 | Drug Info | [87] | |||
7 | AM-831 | Drug Info | [105] | |||
8 | DV-7028 | Drug Info | [109], [110], [111] | |||
9 | 5-CT | Drug Info | [65] | |||
10 | ACP-106 | Drug Info | [30] | |||
11 | AL-37350A | Drug Info | [157] | |||
12 | alpha-methyl-5-HT | Drug Info | [158] | |||
13 | BRL-15572 | Drug Info | [160] | |||
14 | BW723C86 | Drug Info | [65] | |||
15 | LP-12 | Drug Info | [170] | |||
16 | LP-44 | Drug Info | [170] | |||
17 | m-chlorophenylpiperazine | Drug Info | [173] | |||
18 | METHYLENEDIOXYMETHAMPHETAMINE | Drug Info | [174] | |||
19 | MMDA | Drug Info | [175] | |||
20 | N-1-isopropyl-5-MeOT | Drug Info | [172] | |||
21 | N-1-isopropyltryptamine | Drug Info | [172] | |||
22 | Org 12962 | Drug Info | [65] | |||
23 | SB 216641 | Drug Info | [160] | |||
24 | TFMPP | Drug Info | [65], [133] | |||
25 | [125I]DOI | Drug Info | [190] | |||
Partial agonist | [+] 1 Partial agonist drugs | + | ||||
1 | RP5063 | Drug Info | [26] | |||
Binder | [+] 2 Binder drugs | + | ||||
1 | SKL-10406 | Drug Info | [84] | |||
2 | ZD-3638 | Drug Info | [18] | |||
Ligand | [+] 4 Ligand drugs | + | ||||
1 | Aryl piperazine derivative 1 | Drug Info | [38] | |||
2 | Aryl piperazine derivative 6 | Drug Info | [38] | |||
3 | PMID30124346-Compound-13TABLE4 | Drug Info | [38] | |||
4 | PMID30124346-Compound-34TABLE4 | Drug Info | [38] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: Lisuride | Ligand Info | |||||
Structure Description | Crystal structure of serotonin 2A receptor in complex with lisuride | PDB:7WC7 | ||||
Method | X-ray diffraction | Resolution | 2.60 Å | Mutation | Yes | [193] |
PDB Sequence |
LQEKNWSALL
80 TAVVIILTIA90 GNILVIMAVS100 LEKKLQNATN110 YFLMSLAIAD120 MLLGFLVMPV 130 SMLTILYGYR140 WPLPSKLCAV150 WIYLDVLFST160 AKIWHLCAIS170 LDRYVAIQNP 180 SRTKAFLKII197 AVWTISVGIS207 MPIPVFGLQD217 DSKVFKEGSC227 LLADDNFVLI 237 GSFVSFFIPL247 TIMVITYFLT257 IKSLQKEAAD1002 LEDNWETLND1012 NLKVIEKADN 1022 AAQVKDALTK1032 MRAAALDADI1067 LVGQIDDALK1077 LANEGKVKEA1087 QAAAEQLKTT 1097 INAYIQKYGQ313 SISNEQKACK323 VLGIVFFLFV333 VMWCPFFITN343 IMAVICKESC 353 NEDVIGALLN363 VFVWIGYLNS373 AVNPLVYTLF383 NKTYRSAFSR393 YIQCQYKE |
|||||
|
VAL127
4.932
TRP151
3.653
ILE152
3.847
ASP155
2.651
VAL156
3.672
SER159
3.181
THR160
4.377
CYS227
3.864
LEU228
4.061
LEU229
3.662
PHE234
4.085
|
|||||
Ligand Name: Aripiprazole | Ligand Info | |||||
Structure Description | Crystal structure of 5-HT2AR in complex with aripiprazole | PDB:7VOE | ||||
Method | X-ray diffraction | Resolution | 2.90 Å | Mutation | Yes | [194] |
PDB Sequence |
KNWSALLTAV
83 VIILTIAGNI93 LVIMAVSLEK103 KLQNATNYFL113 MSLAIADMLL123 GFLVMPVSML 133 TILYGYRWPL143 PSKLCAVWIY153 LDVLFSTAKI163 WHLCAISLDR173 YVAIQNPSRT 190 KAFLKIIAVW200 TISVGISMPI210 PVFGLQDDSK220 VFKEGSCLLA230 DDNFVLIGSF 240 VSFFIPLTIM250 VITYFLTIKS260 LQKEAADLED1005 NWETLNDNLK1015 VIEKADNAAQ 1025 VKDALTKMRA1035 AALDAGDILV1069 GQIDDALKLA1079 NEGKVKEAQA1089 AAEQLKTTIN 1099 AYIQKYGQSI315 SNEQKACKVL325 GIVFFLFVVM335 WCPFFITNIM345 AVICKESCNE 355 DVIGALLNVF365 VWIGYLNSAV375 NPLVYTLFNK385 TYRSAFSRYI395 QCQYKE |
|||||
|
TRP151
3.568
ILE152
4.226
ASP155
3.388
VAL156
3.688
SER159
3.854
ILE163
4.350
CYS227
3.564
LEU228
3.663
LEU229
4.086
PHE243
3.466
LEU247
3.793
|
|||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Calcium signaling pathway | hsa04020 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
Gap junction | hsa04540 | Affiliated Target |
![]() |
Class: Cellular Processes => Cellular community - eukaryotes | Pathway Hierarchy | ||
Serotonergic synapse | hsa04726 | Affiliated Target |
![]() |
Class: Organismal Systems => Nervous system | Pathway Hierarchy | ||
Inflammatory mediator regulation of TRP channels | hsa04750 | Affiliated Target |
![]() |
Class: Organismal Systems => Sensory system | Pathway Hierarchy |
Degree | 2 | Degree centrality | 2.15E-04 | Betweenness centrality | 2.02E-04 |
---|---|---|---|---|---|
Closeness centrality | 1.86E-01 | Radiality | 1.31E+01 | Clustering coefficient | 0.00E+00 |
Neighborhood connectivity | 2.65E+01 | Topological coefficient | 5.00E-01 | Eccentricity | 12 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 5 KEGG Pathways | + | ||||
1 | Calcium signaling pathway | |||||
2 | Neuroactive ligand-receptor interaction | |||||
3 | Gap junction | |||||
4 | Serotonergic synapse | |||||
5 | Inflammatory mediator regulation of TRP channels | |||||
Panther Pathway | [+] 1 Panther Pathways | + | ||||
1 | 5HT2 type receptor mediated signaling pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Serotonin receptors | |||||
2 | G alpha (q) signalling events | |||||
WikiPathways | [+] 9 WikiPathways | + | ||||
1 | Serotonin Receptor 2 and STAT3 Signaling | |||||
2 | Serotonin Receptor 2 and ELK-SRF/GATA4 signaling | |||||
3 | SIDS Susceptibility Pathways | |||||
4 | Monoamine GPCRs | |||||
5 | GPCRs, Class A Rhodopsin-like | |||||
6 | Gastrin-CREB signalling pathway via PKC and MAPK | |||||
7 | GPCR ligand binding | |||||
8 | GPCR downstream signaling | |||||
9 | GPCRs, Other |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Beneficial effects of sarpogrelate hydrochloride, a 5-HT2A receptor antagonist, supplemented with pioglitazone on diabetic model mice. Endocr Res. 2009;34(1-2):18-30. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4133). | |||||
REF 3 | Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43. | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8182). | |||||
REF 5 | Radium 223 dichloride for prostate cancer treatment. Drug Des Devel Ther. 2017 Sep 6;11:2643-2651. | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 87). | |||||
REF 7 | Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92. | |||||
REF 8 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019 | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7461). | |||||
REF 10 | Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5. | |||||
REF 11 | Pharmacological profile of lurasidone, a novel antipsychotic agent with potent 5-hydroxytryptamine 7 (5-HT7) and 5-HT1A receptor activity. J Pharmacol Exp Ther. 2010 Jul;334(1):171-81. | |||||
REF 12 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 13 | 2016 FDA drug approvals. Nat Rev Drug Discov. 2017 Feb 2;16(2):73-76. | |||||
REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 210). | |||||
REF 15 | A 50-year history of new drugs in Japan-the development and trends of hemostatics and antithrombotic drugs. Yakushigaku Zasshi. 2003;38(1):93-105. | |||||
REF 16 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 103). | |||||
REF 17 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7670). | |||||
REF 18 | The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22. | |||||
REF 19 | ClinicalTrials.gov (NCT02469155) A Trial to Assess the Antipsychotic Efficacy of ITI-007 Over 6 Weeks of Treatment. | |||||
REF 20 | Clinical pipeline report, company report or official report of Intra-Cellular Therapies. | |||||
REF 21 | ClinicalTrials.gov (NCT00495885) Efficacy and Safety of M100907 on Sleep Maintenance Insomnia With a Sub-study in Stable Type II Diabetes Mellitus. U.S. National Institutes of Health. | |||||
REF 22 | ClinicalTrials.gov (NCT03397134) Study to Evaluate Efficacy and Safety of Roluperidone (MIN-101) in Adult Patients With Negative Symptoms of Schizophrenia. U.S. National Institutes of Health. | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017946) | |||||
REF 24 | ClinicalTrials.gov (NCT01295372) Safety and Efficacy of Zicronapine in Patients With Schizophrenia. U.S. National Institutes of Health. | |||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023041) | |||||
REF 26 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 27 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 28 | ClinicalTrials.gov (NCT02035553) A Study of the Safety and Efficacy of Pimavanserin in Patients With Alzheimer's Disease Psychosis. U.S. National Institutes of Health. | |||||
REF 29 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 46). | |||||
REF 30 | Pharmacological profile of the new potent neuroleptic ocaperidone (R 79,598). J Pharmacol Exp Ther. 1992 Jan;260(1):146-59. | |||||
REF 31 | ClinicalTrials.gov (NCT00259311) Efficacy Study of LY2422347 to Treat Insomnia. U.S. National Institutes of Health. | |||||
REF 32 | ClinicalTrials.gov (NCT01490086) RP5063 in Subjects With Schizophrenia or Schizoaffective Disorder. U.S. National Institutes of Health. | |||||
REF 33 | ClinicalTrials.gov (NCT02258152) SYN120 Study to Evaluate Its Safety, Tolerability and Efficacy in Parkinson's Disease Dementia (SYNAPSE) (SYNAPSE). U.S. National Institutes of Health. | |||||
REF 34 | 1192U90 in animal tests that predict antipsychotic efficacy, anxiolysis, and extrapyramidal side effects. Neuropsychopharmacology. 1996 Sep;15(3):231-42. | |||||
REF 35 | Small Molecule Therapeutics for Schizophrenia, Sylvain Celanire. Page(30). | |||||
REF 36 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032727) | |||||
REF 37 | ClinicalTrials.gov (NCT02034292) Safety Study of APD-791 With Aspirin and/or Clopidogrel. U.S. National Institutes of Health. | |||||
REF 38 | 5-HT1A receptor ligands and their therapeutic applications: review of new patents.Expert Opin Ther Pat. 2018 Sep;28(9):679-689. | |||||
REF 39 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 17). | |||||
REF 40 | Psychopathology and psychophysiology of minimal LSD-25 dosage; a preliminary dosage-response spectrum. AMA Arch Neurol Psychiatry. 1958 Feb;79(2):208-10. | |||||
REF 41 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5490). | |||||
REF 42 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001479) | |||||
REF 43 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014343) | |||||
REF 44 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 186). | |||||
REF 45 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000314) | |||||
REF 46 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 97). | |||||
REF 47 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000237) | |||||
REF 48 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. | |||||
REF 49 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 199). | |||||
REF 50 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001117) | |||||
REF 51 | Mechanism of the antihypertensive effect of FCE 22716, a new ergoline derivative, in the spontaneously hypertensive rat. Pharmacology. 1989;38(2):78-92. | |||||
REF 52 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001373) | |||||
REF 53 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000706) | |||||
REF 54 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014358) | |||||
REF 55 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008166) | |||||
REF 56 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016551) | |||||
REF 57 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001777) | |||||
REF 58 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000669) | |||||
REF 59 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001984) | |||||
REF 60 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5434). | |||||
REF 61 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 273). | |||||
REF 62 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000690) | |||||
REF 63 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015510) | |||||
REF 64 | Anxiolytic effects of aniracetam in three different mouse models of anxiety and the underlying mechanism. Eur J Pharmacol. 2001 May 18;420(1):33-43. | |||||
REF 65 | Pharmacological characterisation of the agonist radioligand binding site of 5-HT(2A), 5-HT(2B) and 5-HT(2C) receptors. Naunyn Schmiedebergs Arch Pharmacol. 2004 Aug;370(2):114-23. | |||||
REF 66 | Pimavanserin, a selective serotonin (5-HT)2A-inverse agonist, enhances the efficacy and safety of risperidone, 2mg/day, but does not enhance efficacy of haloperidol, 2mg/day: comparison with reference dose risperidone, 6mg/day.Schizophr Res.2012 Nov;141(2-3):144-52. | |||||
REF 67 | Acute effects of sarpogrelate, a 5-HT2A receptor antagonist on cytokine production in endotoxin shock model of rats. Eur J Pharmacol. 2009 Jul 1;614(1-3):122-7. | |||||
REF 68 | Therapeutic effect of sarpogrelate, a new 5-hydroxytryptamine receptor 2A antagonist, on diabetic nephropathy and neuropathy. Nephron. 1997;76(2):227-9. | |||||
REF 69 | Current and novel approaches to the drug treatment of schizophrenia. J Med Chem. 2001 Feb 15;44(4):477-501. | |||||
REF 70 | Clinical pipeline report, company report or official report of Intra-Cellular Therapies, Inc. | |||||
REF 71 | Antagonism of 5-hydroxytryptamine(2a) receptors attenuates the behavioral effects of cocaine in rats. J Pharmacol Exp Ther. 2001 Apr;297(1):357-63. | |||||
REF 72 | Synthesis and in vitro affinities of various MDL 100907 derivatives as potential 18F-radioligands for 5-HT2A receptor imaging with PET. Bioorg Med Chem. 2009 Apr 15;17(8):2989-3002. | |||||
REF 73 | SR46349-B, a 5-HT(2A/2C) receptor antagonist, potentiates haloperidol-induced dopamine release in rat medial prefrontal cortex and nucleus accumbens. Neuropsychopharmacology. 2002 Sep;27(3):430-41. | |||||
REF 74 | Clinical pipeline report, company report or official report of Tonix Pharmaceuticals. | |||||
REF 75 | Central serotonin receptors as targets for drug research. J Med Chem. 1987 Jan;30(1):1-12. | |||||
REF 76 | Clinical pipeline report, company report or official report of Lundbeck. | |||||
REF 77 | Novel ocular antihypertensive compounds in clinical trials. Clin Ophthalmol. 2011; 5: 667-677. | |||||
REF 78 | Nelotanserin, a novel selective human 5-hydroxytryptamine2A inverse agonist for the treatment of insomnia.J Pharmacol Exp Ther.2010 Jan;332(1):281-90. | |||||
REF 79 | The neuropharmacology of sleep paralysis hallucinations: serotonin 2A activation and a novel therapeutic drug. Psychopharmacology (Berl). 2018 Nov;235(11):3083-3091. | |||||
REF 80 | 5-HT(2A) inverse-agonists for the treatment of insomnia. Curr Top Med Chem. 2008;8(11):969-76. | |||||
REF 81 | Therapeutic strategies for Parkinson disease: beyond dopaminergic drugs. Nat Rev Drug Discov. 2018 Nov;17(11):804-822. | |||||
REF 82 | 7-[3-(1-piperidinyl)propoxy]chromenones as potential atypical antipsychotics. 2. Pharmacological profile of 7-[3-[4-(6-fluoro-1, 2-benzisoxazol-3-yl)-piperidin-1-yl]propoxy]-3-(hydroxymeth yl)chromen -4-one (abaperidone, FI-8602). J Med Chem. 1998 Dec 31;41(27):5402-9. | |||||
REF 83 | Pharmacological characteristics of ATI-9242, a Novel Atypical Antipsychotic. FASEB J, April, 2010, 24(Meeting Abstract Supplement),773.12. | |||||
REF 84 | Bi-directional modulation of BNST neurons by 5-HT: Molecular expression and functional properties of excitatory 5-HT receptor subtypes. Neuroscience. 2009 December 29; 164(4): 1776-1793. | |||||
REF 85 | Clinical pipeline report, company report or official report of Arena Pharmaceuticals. | |||||
REF 86 | Modeling of brain D2 receptor occupancy-plasma concentration relationships with a novel antipsychotic, YKP1358, using serial PET scans in healthy volunteers. Clin Pharmacol Ther. 2007 Feb;81(2):252-8. | |||||
REF 87 | Novel serotonin receptor 2 (5-HT2R) agonists and antagonists: a patent review (2004-2014).Expert Opin Ther Pat. 2016;26(1):89-106. | |||||
REF 88 | C-(4,5,6-trimethoxyindan-1-yl)methanamine: a mescaline analogue designed using a homology model of the 5-HT2A receptor. J Med Chem. 2006 Jul 13;49(14):4269-74. | |||||
REF 89 | Deramciclane, a putative anxiolytic drug, is a serotonin 5-HT2C receptor inverse agonist but fails to induce 5-HT2C receptor down-regulation. Psychopharmacology (Berl). 1998 Mar;136(2):99-104. | |||||
REF 90 | Pharmacokinetics and safety of deramciclane during multiple oral dosing. Int J Clin Pharmacol Ther. 1999 Dec;37(12):589-97. | |||||
REF 91 | Deramciclane (Egis).Curr Opin Investig Drugs.2002 Feb;3(2):289-94. | |||||
REF 92 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 6). | |||||
REF 93 | Ketanserin analogues: structure-affinity relationships for 5-HT2 and 5-HT1C serotonin receptor binding. J Med Chem. 1992 Dec 25;35(26):4903-10. | |||||
REF 94 | Characterization of contractile 5-hydroxytryptamine receptor subtypes in the in situ autoperfused kidney in the anaesthetized rat. Eur J Pharmacol. 2008 Sep 11;592(1-3):133-7. | |||||
REF 95 | Human embryonic stem cell-derived oligodendrocyte progenitor cells express the serotonin receptor and are susceptible to JC virus infection. J Virol. 2008 Sep;82(17):8896-9. | |||||
REF 96 | p-Chloroamphetamine, a serotonin-releasing drug, elicited in rats a hyperglycemia mediated by the 5-HT1A and 5-HT2B/2C receptors. Eur J Pharmacol. 1998 Oct 23;359(2-3):185-90. | |||||
REF 97 | 3-Benzisothiazolylpiperazine derivatives as potential atypical antipsychotic agents. J Med Chem. 1996 Jan 5;39(1):143-8. | |||||
REF 98 | Synthesis and SAR of adatanserin: novel adamantyl aryl- and heteroarylpiperazines with dual serotonin 5-HT(1A) and 5-HT(2) activity as potential anxiolytic and antidepressant agents. J Med Chem. 1999Dec 16;42(25):5077-94. | |||||
REF 99 | Effects of the serotonin antagonist amesergide on reproduction in female rats. Reprod Toxicol. 1993 Nov-Dec;7(6):607-12. | |||||
REF 100 | A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2. | |||||
REF 101 | Serotonergic (5-HT2) mediation of anxiety-therapeutic effects of serazepine in generalized anxiety disorder. Biol Psychiatry. 1993 Jul 1-15;34(1-2):41-4. | |||||
REF 102 | 5-Hydroxytryptamine2 receptor antagonist activity of the acid metabolite (1-isopropyl dihydrolysergic acid) of the ergoline ester, sergolexole (LY281067). J Pharmacol Exp Ther. 1989 Dec;251(3):1006-11. | |||||
REF 103 | Antiplatelet and antithrombotic activity of SL65.0472, a mixed 5-HT1B/5-HT2A receptor antagonist.Thromb Haemost.2001 Mar;85(3):521-8. | |||||
REF 104 | Serotonin reuptake inhibitors: the corner stone in treatment of depression for half a century--a medicinal chemistry survey. Curr Top Med Chem. 2006;6(17):1801-23. | |||||
REF 105 | Clinical pipeline report, company report or official report of Avarx. | |||||
REF 106 | Piperidinyltetralin sigma ligands. J Med Chem. 1994 Feb 4;37(3):364-70. | |||||
REF 107 | Designed multiple ligands. An emerging drug discovery paradigm. J Med Chem. 2005 Oct 20;48(21):6523-43. | |||||
REF 108 | Action of the 5-HT2A antagonist amperozide on alcohol-induced poikilothermia in rats. Pharmacol Biochem Behav. 1998 Jan;59(1):91-5. | |||||
REF 109 | Vascular and cardiac effects of DV-7028, a selective, 5-HT2-receptor antagonist in rats. J Cardiovasc Pharmacol. 1998 Aug;32(2):266-73. | |||||
REF 110 | A potent 5-hydroxytryptamine receptor (5-HT2A) antagonist, DV-7028, delays arterial thrombosis development in rats. Thromb Res. 1998 Jun 15;90(6):259-70. | |||||
REF 111 | Evidence that 5-HT2A receptors are not involved in 5-HT-mediated thermoregulation in mice. Pharmacol Biochem Behav. 1995 Dec;52(4):755-8. | |||||
REF 112 | Autoradiographic studies of RP 62203, a potent 5-HT2 receptor antagonist. Pharmacological characterization of [3H]RP 62203 binding in the rat brain. Eur J Pharmacol. 1993 Mar 16;233(1):37-45. | |||||
REF 113 | Serotonin 5-HT(2A) receptor antagonists in the treatment of insomnia: present status and future prospects.Drugs Today (Barc).2010 Mar;46(3):183-93. | |||||
REF 114 | The 5-hydroxytryptamine2A receptor is involved in (+)-norfenfluramine-induced arterial contraction and blood pressure increase in deoxycorticostero... J Pharmacol Exp Ther. 2007 May;321(2):485-91. | |||||
REF 115 | Some studies on the 5-hydroxytryptamine receptors in the isolated rat uterus. Afr J Med Med Sci. 2002 Dec;31(4):361-5. | |||||
REF 116 | The fenfluramine metabolite (+)-norfenfluramine is vasoactive. J Pharmacol Exp Ther. 2004 May;309(2):845-52. | |||||
REF 117 | Effects of R-102444 and its active metabolite R-96544, selective 5-HT2A receptor antagonists, on experimental acute and chronic pancreatitis: Additional evidence for possible involvement of 5-HT2A receptors in the development of experimental pancreatitis.Eur J Pharmacol.2005 Oct 3;521(1-3):156-63. | |||||
REF 118 | Effects of R-102444, an orally active 5-HT2A receptor antagonist, in rat models of peripheral vascular disease. Vascul Pharmacol. 2004 Feb;41(1):7-13. | |||||
REF 119 | Pharmacological profiles of R-96544, the active form of a novel 5-HT2A receptor antagonist R-102444. Eur J Pharmacol. 2002 Dec 20;457(2-3):107-14. | |||||
REF 120 | Synthesis and structure-activity relationships of a series of substituted 2-(1H-furo[2,3-g]indazol-1-yl)ethylamine derivatives as 5-HT2C receptor a... Bioorg Med Chem. 2008 Feb 15;16(4):1966-82. | |||||
REF 121 | New indole derivatives as potent and selective serotonin uptake inhibitors. J Med Chem. 1993 Apr 30;36(9):1194-202. | |||||
REF 122 | Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. | |||||
REF 123 | Evaluation of isotryptamine derivatives at 5-HT(2) serotonin receptors. Bioorg Med Chem Lett. 2002 Jan 21;12(2):155-8. | |||||
REF 124 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. J Med Chem. 2006 Jan 12;49(1):318-28. | |||||
REF 125 | 2,5-Disubstituted pyridines: the discovery of a novel series of 5-HT2A ligands. Bioorg Med Chem Lett. 2007 May 1;17(9):2643-8. | |||||
REF 126 | N-Propylnoraporphin-11-O-yl carboxylic esters as potent dopamine D(2) and serotonin 5-HT(1A) receptor dual ligands. Bioorg Med Chem. 2008 Sep 15;16(18):8335-8. | |||||
REF 127 | Novel benzodifuran analogs as potent 5-HT2A receptor agonists with ocular hypotensive activity. Bioorg Med Chem Lett. 2007 Jun 1;17(11):2998-3002. | |||||
REF 128 | Design and synthesis of a functionally selective D3 agonist and its in vivo delivery via the intranasal route. Bioorg Med Chem Lett. 2007 Dec 15;17(24):6691-6. | |||||
REF 129 | Synthesis and structure-affinity relationships of novel small molecule natural product derivatives capable of discriminating between serotonin 5-HT1A, 5-HT2A, 5-HT2C receptor subtypes. Bioorg Med Chem. 2010 Jul 1;18(13):4783-92. | |||||
REF 130 | 5-HT1 and 5-HT2 binding characteristics of some quipazine analogues. J Med Chem. 1986 Nov;29(11):2375-80. | |||||
REF 131 | Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. J Med Chem. 2010 Jun 24;53(12):4803-7. | |||||
REF 132 | The role of lipophilicity in determining binding affinity and functional activity for 5-HT2A receptor ligands. Bioorg Med Chem. 2008 Apr 15;16(8):4661-9. | |||||
REF 133 | Synthesis and evaluation of phenyl- and benzoylpiperazines as potential serotonergic agents. J Med Chem. 1986 May;29(5):630-4. | |||||
REF 134 | Structure-activity relationship studies of central nervous system agents. 13. 4-[3-(Benzotriazol-1-yl)propyl]-1-(2-methoxyphenyl)piperazine, a new ... J Med Chem. 1994 Aug 19;37(17):2754-60. | |||||
REF 135 | The synthesis and biological activity of pentafluorosulfanyl analogs of fluoxetine, fenfluramine, and norfenfluramine. Bioorg Med Chem. 2007 Nov 1;15(21):6659-66. | |||||
REF 136 | Synthesis and QSAR studies on hypotensive 1-[3-(4-substituted phenylthio) propyl]-4-(substituted phenyl) piperazines. Bioorg Med Chem Lett. 2007 Mar 15;17(6):1708-12. | |||||
REF 137 | SAR of psilocybin analogs: discovery of a selective 5-HT 2C agonist. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4555-9. | |||||
REF 138 | Methoxy-substituted 9-aminomethyl-9,10-dihydroanthracene (AMDA) derivatives exhibit differential binding affinities at the 5-HT(2A) receptor. Bioorg Med Chem Lett. 2008 Oct 1;18(19):5268-71. | |||||
REF 139 | Influence of the terminal amide fragment geometry in some 3-arylideneindolin-2(1H)-ones on their 5-HT1A/5-HT2A receptor activity. Bioorg Med Chem Lett. 2001 May 7;11(9):1229-31. | |||||
REF 140 | Regioselective synthesis of 3-aryl substituted pyrrolidines via palladium catalyzed arylation: pharmacological evaluation for central dopaminergic and serotonergic activity, Bioorg. Med. Chem. Lett. 7(3):241-246 (1997). | |||||
REF 141 | Exploring the relationship between binding modes of 9-(aminomethyl)-9,10-dihydroanthracene and cyproheptadine analogues at the 5-HT2A serotonin rec... Bioorg Med Chem Lett. 2001 Feb 26;11(4):563-6. | |||||
REF 142 | 1-Aminomethylbenzocycloalkanes: conformationally restricted hallucinogenic phenethylamine analogues as functionally selective 5-HT2A receptor agoni... J Med Chem. 2006 Sep 21;49(19):5794-803. | |||||
REF 143 | Dose-response study of N,N-dimethyltryptamine in humans. I. Neuroendocrine, autonomic, and cardiovascular effects. Arch Gen Psychiatry. 1994 Feb;51(2):85-97. | |||||
REF 144 | 5-HT1 and 5-HT2 binding characteristics of 1-(2,5-dimethoxy-4-bromophenyl)-2-aminopropane analogues. J Med Chem. 1986 Feb;29(2):194-9. | |||||
REF 145 | 4-(3-furyl)-2-(4-methylpiperazino)pyrimidines: Potent 5-HT2A receptor antagonists, Bioorg. Med. Chem. Lett. 7(13):1635-1638 (1997). | |||||
REF 146 | Synthesis, structure-affinity relationships, and modeling of AMDA analogs at 5-HT2A and H1 receptors: structural factors contributing to selectivity. Bioorg Med Chem. 2009 Sep 15;17(18):6496-504. | |||||
REF 147 | Design and synthesis of orally-active and selective azaindane 5HT2c agonist for the treatment of obesity. Bioorg Med Chem Lett. 2010 Jan 1;20(1):266-71. | |||||
REF 148 | 3-(4-Piperidinyl)- and 3-(8-aza-bicyclo[3.2.1]oct-3-yl)-2-phenyl-1H-indoles as bioavailable h5-HT2A antagonists. Bioorg Med Chem Lett. 2000 Dec 18;10(24):2701-3. | |||||
REF 149 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 150 | Cyclic guanidines as dual 5-HT5A/5-HT7 receptor ligands: structure-activity relationship elucidation. Bioorg Med Chem Lett. 2008 Jan 1;18(1):256-61. | |||||
REF 151 | Binding of beta-carbolines at 5-HT(2) serotonin receptors. Bioorg Med Chem Lett. 2003 Dec 15;13(24):4421-5. | |||||
REF 152 | Synthesis and structure-activity relationships of a series of benzazepine derivatives as 5-HT2C receptor agonists. Bioorg Med Chem. 2008 Mar 15;16(6):3309-20. | |||||
REF 153 | New antiinfective and human 5-HT2 receptor binding natural and semisynthetic compounds from the Jamaican sponge Smenospongia aurea. J Nat Prod. 2002 Apr;65(4):476-80. | |||||
REF 154 | 9-Aminomethyl-9,10-dihydroanthracene (AMDA) analogs as structural probes for steric tolerance in 5-HT2A and H1 receptor binding sites. Bioorg Med Chem Lett. 2010 Feb 1;20(3):935-8. | |||||
REF 155 | Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl). 1996 Mar;124(1-2):57-73. | |||||
REF 156 | cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8. | |||||
REF 157 | A novel and selective 5-HT2 receptor agonist with ocular hypotensive activity: (S)-(+)-1-(2-aminopropyl)-8,9-dihydropyrano[3,2-e]indole. J Med Chem. 2003 Sep 11;46(19):4188-95. | |||||
REF 158 | Differential modes of agonist binding to 5-hydroxytryptamine(2A) serotonin receptors revealed by mutation and molecular modeling of conserved residues in transmembrane region 5. Mol Pharmacol. 2000 Nov;58(5):877-86. | |||||
REF 159 | Brominated cyclodipeptides from the marine sponge Geodia barretti as selective 5-HT ligands. J Nat Prod. 2006 Oct;69(10):1421-4. | |||||
REF 160 | SB-216641 and BRL-15572--compounds to pharmacologically discriminate h5-HT1B and h5-HT1D receptors. Naunyn Schmiedebergs Arch Pharmacol. 1997 Sep;356(3):312-20. | |||||
REF 161 | 'Hybrid' benzofuran-benzopyran congeners as rigid analogs of hallucinogenic phenethylamines. Bioorg Med Chem. 2008 Jun 1;16(11):6242-51. | |||||
REF 162 | Mapping the binding site pocket of the serotonin 5-Hydroxytryptamine2A receptor. Ser3.36(159) provides a second interaction site for the protonated amine of serotonin but not of lysergic acid diethylamide or bufotenin. J Biol Chem. 1996 Jun 21;271(25):14672-5. | |||||
REF 163 | Tricyclic dihydroquinazolinones as novel 5-HT2C selective and orally efficacious anti-obesity agents. Bioorg Med Chem Lett. 2010 Feb 1;20(3):1128-33. | |||||
REF 164 | Affinity of cyamemazine, an anxiolytic antipsychotic drug, for human recombinant dopamine vs. serotonin receptor subtypes. Biochem Pharmacol. 2003 Feb 1;65(3):435-40. | |||||
REF 165 | Effects of EGIS-7625, a selective and competitive 5-HT2B receptor antagonist. Cardiovasc Drugs Ther. 2003 Sep-Nov;17(5-6):427-34. | |||||
REF 166 | Role of 5-HT2A receptor antagonists in the treatment of insomnia | |||||
REF 167 | Resolution and absolute configuration of the potent dopamine agonist N,N-diethyl-N'-[(3 alpha, 4a alpha, 10a beta)-1,2,3,4,4a,5,10,10a- -octahydro-... J Med Chem. 1985 Oct;28(10):1540-2. | |||||
REF 168 | 2-Phenylpyrroles as conformationally restricted benzamide analogues. A new class of potential antipsychotics. 1. J Med Chem. 1987 Nov;30(11):2099-104. | |||||
REF 169 | Synthesis and pharmacological evaluation of triflate-substituted analogues of clozapine: identification of a novel atypical neuroleptic. J Med Chem. 1997 Dec 5;40(25):4146-53. | |||||
REF 170 | Structure-activity relationship study on N-(1,2,3,4-tetrahydronaphthalen-1-yl)-4-aryl-1-piperazinehexanamides, a class of 5-HT7 receptor agents. 2. J Med Chem. 2007 Aug 23;50(17):4214-21. | |||||
REF 171 | A novel class of 5-HT2A receptor antagonists: aryl aminoguanidines. Life Sci. 1996;59(15):1259-68. | |||||
REF 172 | Species variations in transmembrane region V of the 5-hydroxytryptamine type 2A receptor alter the structure-activity relationship of certain ergolines and tryptamines. Mol Pharmacol. 1994 Feb;45(2):277-86. | |||||
REF 173 | Comparisons of hallucinogenic phenylisopropylamine binding affinities at cloned human 5-HT2A, -HT(2B) and 5-HT2C receptors. Naunyn Schmiedebergs Arch Pharmacol. 1999 Jan;359(1):1-6. | |||||
REF 174 | The origin of MDMA (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5. | |||||
REF 175 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
REF 176 | 2-Substituted tryptamines: agents with selectivity for 5-HT(6) serotonin receptors. J Med Chem. 2000 Mar 9;43(5):1011-8. | |||||
REF 177 | Synthesis and in vitro binding studies of substituted piperidine naphthamides. Part I: Influence of the substitution on the basic nitrogen and the ... Bioorg Med Chem Lett. 2007 Mar 15;17(6):1565-9. | |||||
REF 178 | Synthesis and in vitro binding studies of substituted piperidine naphthamides. Part II: Influence of the substitution on the benzyl moiety on the a... Bioorg Med Chem Lett. 2007 Mar 15;17(6):1570-4. | |||||
REF 179 | Evidence for possible involvement of 5-HT(2B) receptors in the cardiac valvulopathy associated with fenfluramine and other serotonergic medications. Circulation. 2000 Dec 5;102(23):2836-41. | |||||
REF 180 | Heterocyclic analogues of N-(4-(4-(2,3-dichlorophenyl)piperazin-1-yl)butyl)arylcarboxamides with functionalized linking chains as novel dopamine D3... J Med Chem. 2007 Aug 23;50(17):4135-46. | |||||
REF 181 | Novel, potent, and selective quinoxaline-based 5-HT(3) receptor ligands. 1. Further structure-activity relationships and pharmacological characteri... J Med Chem. 2009 Nov 12;52(21):6946-50. | |||||
REF 182 | Attenuation of haloperidol-induced catalepsy by a 5-HT2C receptor antagonist. Br J Pharmacol. 1999 Feb;126(3):572-4. | |||||
REF 183 | Biarylcarbamoylindolines are novel and selective 5-HT(2C) receptor inverse agonists: identification of 5-methyl-1-[[2-[(2-methyl-3-pyridyl)oxy]- 5-pyridyl]carbamoyl]-6-trifluoromethylindoline (SB-243213) as a potential antidepressant/anxiolytic agent. J Med Chem. 2000 Mar 23;43(6):1123-34. | |||||
REF 184 | SB 242084, a selective and brain penetrant 5-HT2C receptor antagonist. Neuropharmacology. 1997 Apr-May;36(4-5):609-20. | |||||
REF 185 | Discovery of 3-aryl-3-methyl-1H-quinoline-2,4-diones as a new class of selective 5-HT6 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 15;18(2):738-43. | |||||
REF 186 | Pyrrolo(iso)quinoline derivatives as 5-HT(2C) receptor agonists. Bioorg Med Chem Lett. 2006 Feb;16(3):677-80. | |||||
REF 187 | Indoline derivatives as 5-HT(2C) receptor agonists. Bioorg Med Chem Lett. 2004 May 3;14(9):2367-70. | |||||
REF 188 | Novel 1-aminoethyl-3-arylsulfonyl-1H-pyrrolo[2,3-b]pyridines are potent 5-HT(6) agonists. Bioorg Med Chem. 2009 Jul 15;17(14):5153-63. | |||||
REF 189 | Autoradiographic localization of 5-HT(2A) receptors in the human brain using [(3)H]M100907 and [(11)C]M100907. Synapse. 2000 Dec 15;38(4):421-31. | |||||
REF 190 | Effect of ring fluorination on the pharmacology of hallucinogenic tryptamines. J Med Chem. 2000 Nov 30;43(24):4701-10. | |||||
REF 191 | Visualisation of loss of 5-HT2A receptors with age in healthy volunteers using [18F]altanserin and positron emission tomographic imaging. Psychiatry Res. 1996 Nov 25;68(1):11-22. | |||||
REF 192 | Activity of Parthenolide at 5HT2A receptors. J Nat Prod. 1997 Jun;60(6):651-3. | |||||
REF 193 | Structure-based discovery of nonhallucinogenic psychedelic analogs. Science. 2022 Jan 28;375(6579):403-411. | |||||
REF 194 | Structure-based design of a novel third-generation antipsychotic drug lead with potential antidepressant properties. Nat Neurosci. 2022 Jan;25(1):39-49. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.