Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T35527 | Target Info | |||
Target Name | Arachidonate 12-lipoxygenase (12-LOX) | ||||
Synonyms | Platelet-type lipoxygenase 12; Lipoxin synthase 12-LO; LOG12; Arachidonate 12-lipoxygenase, 12S-type; 12S-lipoxygenase; 12S-LOX; 12LO; 12-lipoxygenase | ||||
Target Type | Literature-reported Target | ||||
Gene Name | ALOX12 | ||||
Biochemical Class | Oxygenase | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | NF-kappa-B p65-p65 (NFKB) homodimer | ||||
Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
Class | RHR (Rel homology region) | ||||
Family | Rel/ankyrin | ||||
Regulation Type | Decrease | ||||
Regulation Mechanism | As examined by the luciferase assay, a negative regulatory region including the NFKB motif was found in the 5'-flanking region of the ALOX12 gene in human erythroleukemia cells. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
UniProt ID | |||||
Sequence |
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM DFSALLSQISS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
Cytokines / Cytokine receptors | [+] 3 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
Transcription factors | [+] 2 Transcription factors Co-regulated By This TF | + | |||
TF Name | NF-kappa-B c-Rel-c-Rel (NFKB) homodimer | ||||
Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
Class | RHR (Rel homology region) | ||||
Family | Rel/ankyrin | ||||
Regulation Type | Decrease | ||||
Regulation Mechanism | As examined by the luciferase assay, a negative regulatory region including the NFKB motif was found in the 5'-flanking region of the ALOX12 gene in human erythroleukemia cells. | [1] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII TRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF QKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYF KKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTP RSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSA DLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMS SSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGI GSMQNEQLSDSFPYEFFQV |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 4 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
TF Name | NF-kappa-B p50-p50 (NFKB) homodimer | ||||
Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
Class | RHR (Rel homology region) | ||||
Family | Rel/ankyrin | ||||
Regulation Type | Decrease | ||||
Regulation Mechanism | As examined by the luciferase assay, a negative regulatory region including the NFKB motif was found in the 5'-flanking region of the ALOX12 gene in human erythroleukemia cells. | [1] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ EGPLEGKI |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
Apoptosis regulators | [+] 1 Apoptosis regulators Co-regulated By This TF | + | |||
CD antigens | [+] 1 CD antigens Co-regulated By This TF | + | |||
Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + | |||
TF Name | Sp1 transcription factor (SP1) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys2His2 zinc finger domain | ||||
Family | Ubiquitous factors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Two specific Sp1 consensus sites are involved in the mediation of the basal promoter activity as well as EGF induction of the ALOX12 gene and that Sp1 and Sp3 transcription factors might have a role in their regulation. | [2] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSP
LALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTS KEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQ TVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQG LANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVT SGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVS GLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPL SGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQ TITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTS GIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTR REACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTW SYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALS VGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINI SGNGF |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Acyltransferases | [+] 2 Acyltransferases Co-regulated By This TF | + | |||
Apolipoproteins | [+] 2 Apolipoproteins Co-regulated By This TF | + | |||
Apoptosis regulators | [+] 1 Apoptosis regulators Co-regulated By This TF | + | |||
Carbon-nitrogen hydrolases | [+] 1 Carbon-nitrogen hydrolases Co-regulated By This TF | + | |||
Caveolin proteins | [+] 1 Caveolin proteins Co-regulated By This TF | + | |||
Collagens | [+] 1 Collagens Co-regulated By This TF | + | |||
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
Ester hydrolases | [+] 2 Ester hydrolases Co-regulated By This TF | + | |||
G protein-coupled receptors | [+] 3 G protein-coupled receptors Co-regulated By This TF | + | |||
Glycoproteins | [+] 2 Glycoproteins Co-regulated By This TF | + | |||
Growth factors | [+] 4 Growth factors Co-regulated By This TF | + | |||
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
Integrins | [+] 1 Integrins Co-regulated By This TF | + | |||
Kinases | [+] 5 Kinases Co-regulated By This TF | + | |||
Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
Lyases | [+] 2 Lyases Co-regulated By This TF | + | |||
Nuclear hormone receptors | [+] 2 Nuclear hormone receptors Co-regulated By This TF | + | |||
Oxidoreductases | [+] 9 Oxidoreductases Co-regulated By This TF | + | |||
Peptidases | [+] 4 Peptidases Co-regulated By This TF | + | |||
Pro-neuropeptides | [+] 1 Pro-neuropeptides Co-regulated By This TF | + | |||
Small GTPases | [+] 1 Small GTPases Co-regulated By This TF | + | |||
Somatotropin / Prolactins | [+] 1 Somatotropin / Prolactins Co-regulated By This TF | + | |||
Transcription factors | [+] 2 Transcription factors Co-regulated By This TF | + | |||
Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
Zinc-fingers | [+] 1 Zinc-fingers Co-regulated By This TF | + | |||
TF Name | Sp3 transcription factor (SP3) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys2His2 zinc finger domain | ||||
Family | Ubiquitous factors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Two specific Sp1 consensus sites are involved in the mediation of the basal promoter activity as well as EGF induction of the ALOX12 gene and that Sp1 and Sp3 transcription factors might have a role in their regulation. | [2] | |||
Evidence Score (E-score) | 1 | + | |||
UniProt ID | |||||
Sequence |
MTAPEKPVKQEEMAALDVDSGGGGGGGGGHGEYLQQQQQHGNGAVAAAAAAQDTQPSPLA
LLAATCSKIGPPSPGDDEEEAAAAAGAPAAAGATGDLASAQLGGAPNRWEVLSATPTTIK DEAGNLVQIPSAATSSGQYVLPLQNLQNQQIFSVAPGSDSSNGTVSSVQYQVIPQIQSAD GQQVQIGFTGSSDNGGINQESSQIQIIPGSNQTLLASGTPSANIQNLIPQTGQVQVQGVA IGGSSFPGQTQVVANVPLGLPGNITFVPINSVDLDSLGLSGSSQTMTAGINADGHLINTG QAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSS GQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQT IHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQ NTAAQQITLTPVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGE NADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVAC TCPNCKEGGGRGTNLGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGK RFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQNKKGIHSSSTVLASVE AARDDTLITAGGTTLILANIQQGSVSGIGTVNTSATSNQDILTNTEIPLQLVTVSGNETM E |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Acyltransferases | [+] 1 Acyltransferases Co-regulated By This TF | + | |||
Collagens | [+] 1 Collagens Co-regulated By This TF | + | |||
Glycoproteins | [+] 1 Glycoproteins Co-regulated By This TF | + | |||
Growth factors | [+] 1 Growth factors Co-regulated By This TF | + | |||
Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
Lyases | [+] 1 Lyases Co-regulated By This TF | + | |||
Oxidoreductases | [+] 3 Oxidoreductases Co-regulated By This TF | + | |||
Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + | |||
Zinc-fingers | [+] 1 Zinc-fingers Co-regulated By This TF | + |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | The transcriptional regulation of human arachidonate 12-lipoxygenase gene by NF kappa B/Rel. FEBS Lett. 1995 Apr 17;363(1-2):105-10. | ||||
REF 2 | Transcriptional activation of human 12-lipoxygenase gene promoter is mediated through Sp1 consensus sites in A431 cells. Biochem J. 1997 May 15;324 ( Pt 1):133-40. | ||||
REF 3 | Survivin regulation by HER2 through NF-B and c-myc in irradiated breast cancer cells. J Cell Mol Med. 2011 Jul;15(7):1542-50. | ||||
REF 4 | Apo CIII gene transcription is regulated by a cytokine inducible NF-kappa B element. Nucleic Acids Res. 1994 Jun 25;22(12):2417-22. | ||||
REF 5 | Characterization of a functional NF-kappa B site in the human interleukin 1 beta promoter: evidence for a positive autoregulatory loop. Mol Cell Biol. 1993 Oct;13(10):6231-40. | ||||
REF 6 | Inhibition of IL-12 production by 1,25-dihydroxyvitamin D3. Involvement of NF-kappaB downregulation in transcriptional repression of the p40 gene. J Clin Invest. 1998 Jan 1;101(1):252-62. | ||||
REF 7 | Inhibition of NF-AT-dependent transcription by NF-kappa B: implications for differential gene expression in T helper cell subsets. Proc Natl Acad Sci U S A. 1995 Dec 5;92(25):11623-7. | ||||
REF 8 | Flanking sequences for the human intercellular adhesion molecule-1 NF-kappaB response element are necessary for tumor necrosis factor alpha-induced gene expression. J Biol Chem. 1997 Jun 20;272(25):15928-35. | ||||
REF 9 | Expression of human p53 requires synergistic activation of transcription from the p53 promoter by AP-1, NF-kappaB and Myc/Max. Oncogene. 1999 Apr 29;18(17):2728-38. | ||||
REF 10 | Synergy between interferon-gamma and tumor necrosis factor-alpha in transcriptional activation is mediated by cooperation between signal transducer and activator of transcription 1 and nuclear factor kappaB. J Biol Chem. 1997 Jun 6;272(23):14899-907. | ||||
REF 11 | The c-rel protooncogene product c-Rel but not NF-kappa B binds to the intronic region of the human interferon-gamma gene at a site related to an in... Proc Natl Acad Sci U S A. 1992 Mar 1;89(5):1740-4. | ||||
REF 12 | Kappa B site-dependent activation of the interleukin-2 receptor alpha-chain gene promoter by human c-Rel. Mol Cell Biol. 1992 Sep;12(9):4067-75. | ||||
REF 13 | Identification and characterization of a novel Ets-2-related nuclear complex implicated in the activation of the human interleukin-12 p40 gene prom... J Biol Chem. 1997 Apr 18;272(16):10389-95. | ||||
REF 14 | NF-kappaB1 (p50) homodimers contribute to transcription of the bcl-2 oncogene. J Biol Chem. 2001 Nov 30;276(48):45380-6. | ||||
REF 15 | Endothelial interferon regulatory factor 1 cooperates with NF-kappa B as a transcriptional activator of vascular cell adhesion molecule 1. Mol Cell Biol. 1995 May;15(5):2558-69. | ||||
REF 16 | cis-acting elements and transcription factors involved in the promoter activity of the human factor VIII gene. J Biol Chem. 1995 May 19;270(20):11828-38. | ||||
REF 17 | Sp1-mediated transcriptional activation of the human Pi class glutathione S-transferase promoter. J Biol Chem. 1996 Jan 12;271(2):1054-60. | ||||
REF 18 | Binding and functional effects of transcription factors Sp1 and Sp3 on the proximal human lecithin:cholesterol acyltransferase promoter. J Lipid Res. 1998 May;39(5):969-77. | ||||
REF 19 | Involvement of early growth response factor Egr-1 in apolipoprotein AI gene transcription. J Biol Chem. 1995 Mar 24;270(12):7004-10. | ||||
REF 20 | Characterization of a human apolipoprotein E gene enhancer element and its associated protein factors. J Biol Chem. 1990 Jun 5;265(16):9496-504. | ||||
REF 21 | Regulation of MCL1 through a serum response factor/Elk-1-mediated mechanism links expression of a viability-promoting member of the BCL2 family to the induction of hematopoietic cell differentiation. J Biol Chem. 1999 Jan 15;274(3):1801-13. | ||||
REF 22 | Sp1 is essential for both enhancer-mediated and basal activation of the TATA-less human adenosine deaminase promoter. Nucleic Acids Res. 1994 Feb 25;22(4):669-77. | ||||
REF 23 | Intracellular cholesterol transport in synchronized human skin fibroblasts. Biochemistry. 1999 Feb 23;38(8):2506-13. | ||||
REF 24 | Transforming growth factor-beta stimulates alpha 2(I) collagen gene expression through a cis-acting element that contains an Sp1-binding site. J Biol Chem. 1994 May 20;269(20):14828-34. | ||||
REF 25 | Regulation of transcription of the human erythropoietin receptor gene by proteins binding to GATA-1 and Sp1 motifs. Nucleic Acids Res. 1995 Aug 11;23(15):3041-9. | ||||
REF 26 | The nuclear factor YY1 suppresses the human gamma interferon promoter through two mechanisms: inhibition of AP1 binding and activation of a silence... Mol Cell Biol. 1996 Sep;16(9):4744-53. | ||||
REF 27 | Transcription factor repression and activation of the human acetylcholinesterase gene. J Biol Chem. 1995 Oct 6;270(40):23511-9. | ||||
REF 28 | Cell cycle regulation of cdc25C transcription is mediated by the periodic repression of the glutamine-rich activators NF-Y and Sp1. Nucleic Acids Res. 1995 Oct 11;23(19):3822-30. | ||||
REF 29 | The serotonin 1a receptor gene contains a TATA-less promoter that responds to MAZ and Sp1. J Biol Chem. 1996 Feb 23;271(8):4417-30. | ||||
REF 30 | Genomic organization and functional characterization of the chemokine receptor CXCR4, a major entry co-receptor for human immunodeficiency virus type 1. J Biol Chem. 1998 Feb 20;273(8):4754-60. | ||||
REF 31 | Novel role for Sp1 in phorbol ester enhancement of human platelet thromboxane receptor gene expression. J Biol Chem. 1996 Aug 16;271(33):19696-704. | ||||
REF 32 | Transcriptional regulation of the cholesteryl ester transfer protein gene by the orphan nuclear hormone receptor apolipoprotein AI regulatory protein-1. J Biol Chem. 1995 Dec 15;270(50):29916-22. | ||||
REF 33 | The human uncoupling protein-3 gene promoter requires MyoD and is induced by retinoic acid in muscle cells. FASEB J. 2000 Nov;14(14):2141-3. | ||||
REF 34 | The Wilms' tumor gene product, WT1, represses transcription of the platelet-derived growth factor A-chain gene. J Biol Chem. 1992 Nov 5;267(31):21999-2002. | ||||
REF 35 | Identification of a thrombin response element in the human platelet-derived growth factor B-chain (c-sis) promoter. J Biol Chem. 1996 Feb 9;271(6):3025-32. | ||||
REF 36 | Acceleration of thrombomodulin gene transcription by retinoic acid: retinoic acid receptors and Sp1 regulate the promoter activity through interactions with two different sequences in the 5'-flanking region of human gene. J Biol Chem. 2001 Jan 26;276(4):2440-50. | ||||
REF 37 | Regulation of the transforming growth factor-beta 1 and -beta 3 promoters by transcription factor Sp1. Gene. 1993 Jul 30;129(2):223-8. | ||||
REF 38 | Stat1 depends on transcriptional synergy with Sp1. J Biol Chem. 1995 Dec 22;270(51):30264-7. | ||||
REF 39 | Binding of phosphorylated Sp1 protein to tandem Sp1 binding sites regulates alpha2 integrin gene core promoter activity. Blood. 1997 Jul 15;90(2):678-89. | ||||
REF 40 | Transcription factors ets1, NF-kappa B, and Sp1 are major determinants of the promoter activity of the human protein kinase CK2alpha gene. J Biol Chem. 2000 Jun 16;275(24):18327-36. | ||||
REF 41 | Identification of an estrogen-mediated deoxyribonucleic acid-binding independent transactivation pathway on the epidermal growth factor receptor gene promoter. Endocrinology. 2000 Jun;141(6):2266-74. | ||||
REF 42 | The human Pim-1 gene is selectively transcribed in different hemato-lymphoid cell lines in spite of a G + C-rich housekeeping promoter. Mol Cell Biol. 1990 Apr;10(4):1680-8. | ||||
REF 43 | Sp1 cooperates with c-Myc to activate transcription of the human telomerase reverse transcriptase gene (hTERT). Nucleic Acids Res. 2000 Feb 1;28(3):669-77. | ||||
REF 44 | Constitutive protection of E2F recognition sequences in the human thymidine kinase promoter during cell cycle progression. J Biol Chem. 1997 Nov 28;272(48):30483-90. | ||||
REF 45 | Co-stimulation of promoter for low density lipoprotein receptor gene by sterol regulatory element-binding protein and Sp1 is specifically disrupted by the yin yang 1 protein. J Biol Chem. 1999 May 7;274(19):13025-32. | ||||
REF 46 | Mast cell-/basophil-specific transcriptional regulation of human L-histidine decarboxylase gene by CpG methylation in the promoter region. J Biol Chem. 1998 Nov 20;273(47):31607-14. | ||||
REF 47 | Cell-specific transcription of leukotriene C(4) synthase involves a Kruppel-like transcription factor and Sp1. J Biol Chem. 2000 Mar 24;275(12):8903-10. | ||||
REF 48 | Regulatory mechanisms controlling human hepatocyte nuclear factor 4alpha gene expression. Mol Cell Biol. 2001 Nov;21(21):7320-30. | ||||
REF 49 | Sp1 binding sites and an estrogen response element half-site are involved in regulation of the human progesterone receptor A promoter. Mol Endocrinol. 2000 Jul;14(7):972-85. | ||||
REF 50 | Minimal sequence and factor requirements for the initiation of transcription from an atypical, TATATAA box-containing housekeeping promoter. J Biol Chem. 1990 Nov 25;265(33):20524-32. | ||||
REF 51 | Regulation of the catalase gene promoter by Sp1, CCAAT-recognizing factors, and a WT1/Egr-related factor in hydrogen peroxide-resistant HP100 cells. Cancer Res. 2001 Aug 1;61(15):5885-94. | ||||
REF 52 | Actions of two different cAMP-responsive sequences and an enhancer of the human CYP11A1 (P450scc) gene in adrenal Y1 and placental JEG-3 cells. J Biol Chem. 1994 Mar 4;269(9):6362-9. | ||||
REF 53 | Noradrenergic-specific transcription of the dopamine beta-hydroxylase gene requires synergy of multiple cis-acting elements including at least two Phox2a-binding sites. J Neurosci. 1998 Oct 15;18(20):8247-60. | ||||
REF 54 | The proximal promoter region of the gene encoding human 17beta-hydroxysteroid dehydrogenase type 1 contains GATA, AP-2, and Sp1 response elements: analysis of promoter function in choriocarcinoma cells. Endocrinology. 1997 Aug;138(8):3417-25. | ||||
REF 55 | Co-operation of the transcription factor hepatocyte nuclear factor-4 with Sp1 or Sp3 leads to transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line. Biochem J. 2002 Nov 1;367(Pt 3):641-52. | ||||
REF 56 | Transcriptional regulation of endothelial nitric-oxide synthase by lysophosphatidylcholine. J Biol Chem. 1998 Jun 12;273(24):14885-90. | ||||
REF 57 | Sp1 and C/EBP-related factor regulate the transcription of human Cu/Zn SOD gene. Gene. 1996 Oct 31;178(1-2):177-85. | ||||
REF 58 | The human caspase-8 promoter sustains basal activity through SP1 and ETS-like transcription factors and can be up-regulated by a p53-dependent mechanism. J Biol Chem. 2003 Jul 25;278(30):27593-604. | ||||
REF 59 | Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells. J Biol Chem. 1994 Jun 3;269(22):15912-7. | ||||
REF 60 | Expression of the dibasic proprotein processing enzyme furin is directed by multiple promoters. J Biol Chem. 1994 Mar 25;269(12):9298-303. | ||||
REF 61 | Cloning and functional characterization of the 5' flanking region of the human mitochondrial malic enzyme gene. Regulatory role of Sp1 and AP-2. Eur J Biochem. 2001 May;268(10):3017-27. | ||||
REF 62 | Transcriptional regulation of the human neuropeptide Y gene by nerve growth factor. J Biol Chem. 1994 Jun 3;269(22):15460-8. | ||||
REF 63 | Effect of abasic linker substitution on triplex formation, Sp1 binding, and specificity in an oligonucleotide targeted to the human Ha-ras promoter. Nucleic Acids Res. 1994 May 25;22(10):1909-16. | ||||
REF 64 | Sp1 and thyroid hormone receptor differentially activate expression of human growth hormone and chorionic somatomammotropin genes. J Biol Chem. 1991 May 25;266(15):9805-13. | ||||
REF 65 | Cloning and characterization of the 5'-flanking region of the human transcription factor Sp1 gene. J Biol Chem. 2001 Jun 22;276(25):22126-32. | ||||
REF 66 | Characterization of the transcriptional regulatory region of the human WT1 gene. Oncogene. 1993 Nov;8(11):3123-32. | ||||
REF 67 | YY1 and Sp1 transcription factors bind the human transferrin gene in an age-related manner. J Gerontol A Biol Sci Med Sci. 1996 Jan;51(1):B66-75. | ||||
REF 68 | Sp1 and Sp3 physically interact and co-operate with GABP for the activation of the utrophin promoter. J Mol Biol. 2001 Mar 9;306(5):985-96. | ||||
REF 69 | Oncostatin M stimulates transcription of the human alpha2(I) collagen gene via the Sp1/Sp3-binding site. J Biol Chem. 1997 Sep 26;272(39):24666-72. | ||||
REF 70 | c-sis/PDGF-B promoter transactivation by the Yax protein of human T-cell leukemia virus type 1. J Biol Chem. 1996 Jun 14;271(24):14584-90. | ||||
REF 71 | Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.