Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T48873
|
||||
Former ID |
TTDS00118
|
||||
Target Name |
Synaptic vesicle amine transporter
|
||||
Gene Name |
SLC18A2
|
||||
Synonyms |
Monoamine transporter; Solute carrier family 18 member 2; VAT; VMAT; Vesicular Monoamine Transporter ; Vesicular amine transporter; SLC18A2
|
||||
Target Type |
Successful
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Chorea associated with huntington's disease [ICD10: G10] | |||||
Hypertension [ICD9: 401; ICD10: I10-I16] | |||||
Huntington's disease; Hyperkinetic movement disorder [ICD9:294.1, 333.4, 333; ICD10: F02.2, G10, G20-G26] | |||||
High blood pressure [ICD9: 401; ICD10: I10-I16] | |||||
Movement disorder [ICD10: R25] | |||||
Substance dependence [ICD10: F10-F19] | |||||
Tardive dyskinesia [ICD10: G24] | |||||
Function |
Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.
|
||||
BioChemical Class |
Major facilitator superfamily
|
||||
Target Validation |
T48873
|
||||
UniProt ID | |||||
Sequence |
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEI
QTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSE DKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSS SYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGS VLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGS ICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLC ALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKM AILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD |
||||
Drugs and Mode of Action | |||||
Drug(s) | Alkavervir | Drug Info | Approved | High blood pressure | [1] |
Alseroxylon | Drug Info | Approved | Hypertension | [2] | |
Deutetrabenazine | Drug Info | Approved | Chorea associated with huntington's disease | [3] | |
Reserpine | Drug Info | Approved | Hypertension | [4], [5] | |
Tetrabenazine | Drug Info | Approved | Huntington's disease; Hyperkinetic movement disorder | [6], [7], [8], [9], [10], [1] | |
Valbenazine Tosylate | Drug Info | Approved | Tardive dyskinesia | [3] | |
AV 133 | Drug Info | Phase 3 | Alzheimer disease | [11] | |
NBI-98854 | Drug Info | Phase 3 | Movement disorder | [12], [13] | |
Lobeline | Drug Info | Phase 2 | Substance dependence | [14] | |
Antagonist | 3,4-Methylenedioxymethamphetamine | Drug Info | [15] | ||
4-Methoxyamphetamine | Drug Info | [16] | |||
MMDA | Drug Info | [17] | |||
Modulator | Alkavervir | Drug Info | [18] | ||
Deutetrabenazine | Drug Info | [18] | |||
Valbenazine Tosylate | Drug Info | [18] | |||
Blocker | Alseroxylon | Drug Info | [19] | ||
Reserpine | Drug Info | [20] | |||
Tetrabenazine | Drug Info | [21], [20] | |||
Enhancer | AV 133 | Drug Info | [22] | ||
Inhibitor | Lobeline | Drug Info | [23] | ||
NBI-98854 | Drug Info | [24] | |||
[11C]DTBZ | Drug Info | [25] | |||
[125I]7-azido-8-iodoketanserine | Drug Info | [26] | |||
[3H]TBZOH | Drug Info | [27] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Synaptic vesicle cycle | ||||
Serotonergic synapse | |||||
Dopaminergic synapse | |||||
Parkinson' | |||||
s disease | |||||
Cocaine addiction | |||||
Amphetamine addiction | |||||
Alcoholism | |||||
PANTHER Pathway | Adrenaline and noradrenaline biosynthesis | ||||
5HT1 type receptor mediated signaling pathway | |||||
5HT2 type receptor mediated signaling pathway | |||||
5HT3 type receptor mediated signaling pathway | |||||
5HT4 type receptor mediated signaling pathway | |||||
Dopamine receptor mediated signaling pathway | |||||
Nicotine pharmacodynamics pathway | |||||
CCKR signaling map ST | |||||
Reactome | Norepinephrine Neurotransmitter Release Cycle | ||||
Na+/Cl- dependent neurotransmitter transporters | |||||
WikiPathways | Dopaminergic Neurogenesis | ||||
Synaptic Vesicle Pathway | |||||
Neurotransmitter Release Cycle | |||||
Nicotine Activity on Dopaminergic Neurons | |||||
References | |||||
REF 1 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 2 | Drug information of Alseroxylon, 2008. eduDrugs. | ||||
REF 3 | Drugs@FDA (Edaravone) | ||||
REF 4 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4823). | ||||
REF 5 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 009838. | ||||
REF 6 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4834). | ||||
REF 7 | 2008 FDA drug approvals. Nat Rev Drug Discov. 2009 Feb;8(2):93-6. | ||||
REF 8 | Role of tetrabenazine for Huntington's disease-associated chorea. Ann Pharmacother. 2010 Jun;44(6):1080-9. | ||||
REF 9 | The druggable genome: Evaluation of drug targets in clinical trials suggests major shifts in molecular class and indication. Annu Rev Pharmacol Toxicol. 2014;54:9-26. | ||||
REF 10 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 021894. | ||||
REF 11 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027191) | ||||
REF 12 | ClinicalTrials.gov (NCT02274558) A Phase 3 Study of NBI-98854 for the Treatment of Tardive Dyskinesia. U.S. National Institutes of Health. | ||||
REF 13 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8694). | ||||
REF 14 | Effects of VMAT2 inhibitors lobeline and GZ-793A on methamphetamine-induced changes in dopamine release, metabolism and synthesis in vivo. J Neurochem. 2013 Oct;127(2):187-98. | ||||
REF 15 | The origin of <span class="caps">MDMA</span> (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5. | ||||
REF 16 | Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77. | ||||
REF 17 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 18 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | ||||
REF 19 | Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. | ||||
REF 20 | Dopamine signaling is required for depolarization-induced slow current in cerebellar Purkinje cells. J Neurosci. 2009 Jul 1;29(26):8530-8. | ||||
REF 21 | 11C-dihydrotetrabenazine PET of the pancreas in subjects with long-standing type 1 diabetes and in healthy controls. J Nucl Med. 2009 Mar;50(3):382-9. Epub 2009 Feb 17. | ||||
REF 22 | Brain imaging of vesicular monoamine transporter type 2 in healthy aging subjects by 18F-FP-(+)-DTBZ PET. PLoS One. 2013 Sep 30;8(9):e75952. | ||||
REF 23 | Design, synthesis and interaction at the vesicular monoamine transporter-2 of lobeline analogs: potential pharmacotherapies for the treatment of psychostimulant abuse. Curr Top Med Chem. 2011;11(9):1103-27. | ||||
REF 24 | NBI-98854, a selective monoamine transport inhibitor for the treatment of tardive dyskinesia: A randomized, double-blind, placebo-controlled study. Mov Disord. 2015 Oct;30(12):1681-7. | ||||
REF 25 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1012). | ||||
REF 26 | Peptide mapping of the [125I]Iodoazidoketanserin and [125I]2-N-[(3'-iodo-4'-azidophenyl)propionyl]tetrabenazine binding sites for the synaptic vesicle monoamine transporter. J Biol Chem. 1997 Oct 10;272(41):26049-55. | ||||
REF 27 | Active transport of acetylcholine by the human vesicular acetylcholine transporter. J Biol Chem. 1996 Nov 1;271(44):27229-32. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.