Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T94918
|
|||||
| Target Name |
COVID-19 RNA-directed RNA polymerase (RdRp)
|
|||||
| Synonyms |
COVID-19 Pol; COVID-19 nsp12
Click to Show/Hide
|
|||||
| Gene Name |
COVID-19 rep; COVID-19 1a-1b
|
|||||
| Disease | [+] 4 Target-related Diseases | + | ||||
| 1 | Candidosis [ICD-11: 1F23] | |||||
| 2 | COVID-19 [ICD-11: 1D6Y] | |||||
| 3 | Herpes simplex infection [ICD-11: 1F00] | |||||
| 4 | Influenza [ICD-11: 1E30-1E32] | |||||
| Function |
Responsible for replication and transcription of the viral RNA genome.
Click to Show/Hide
|
|||||
| BioChemical Class |
Coronaviruses polyprotein 1ab family
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 2.7.7.48
|
|||||
| Sequence |
SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKD
EDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLT KYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGE RVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSL LMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVN CLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVN LHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFY DFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYF DCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTIT QMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHN MLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECA QVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYV RNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIK NFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGA GCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHML DMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Investigative Agents | [+] 3 | + | ||||
| 1 | Anidulafungin | Drug Info | Approved | Candidiasis | [2] | |
| 2 | Penciclovir | Drug Info | Approved | Recurrent herpes labialis | [2] | |
| 3 | Suramin | Drug Info | Phase 1 | African trypanosomiasis | [7] | |
| Drugs in Phase 3 Trial | [+] 2 | + | ||||
| 1 | Favipiravir | Drug Info | Approved | Influenza virus infection | [2] | |
| 2 | Remdesivir | Drug Info | Phase 3 | Coronavirus Disease 2019 (COVID-19) | [4] | |
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Remdesivir | Drug Info | Approved | Coronavirus Disease 2019 (COVID-19) | [3] | |
| Drugs in Phase 2 Trial | [+] 1 | + | ||||
| 1 | Lopinavir + ritonavir + ribavirin + interferon beta-1b | Drug Info | Phase 2 | Coronavirus Disease 2019 (COVID-19) | [5] | |
| Drugs in Phase 1 Trial | [+] 1 | + | ||||
| 1 | Galidesivir | Drug Info | Phase 1 | Coronavirus Disease 2019 (COVID-19) | [6] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Inhibitor | [+] 7 Inhibitor drugs | + | ||||
| 1 | Remdesivir | Drug Info | [3] | |||
| 2 | Favipiravir | Drug Info | [8], [9] | |||
| 3 | Remdesivir | Drug Info | [1], [10] | |||
| 4 | Lopinavir + ritonavir + ribavirin + interferon beta-1b | Drug Info | [9] | |||
| 5 | Anidulafungin | Drug Info | [12] | |||
| 6 | Penciclovir | Drug Info | [10], [12] | |||
| 7 | Suramin | Drug Info | [12] | |||
| Blocker | [+] 1 Blocker drugs | + | ||||
| 1 | Galidesivir | Drug Info | [11] | |||
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Comparative therapeutic efficacy of remdesivir and combination lopinavir, ritonavir, and interferon beta against MERS-CoV. Nat Commun. 2020 Jan 10;11(1):222. | |||||
| REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020 | |||||
| REF 4 | ClinicalTrials.gov (NCT04315948) Trial of Treatments for COVID-19 in Hospitalized Adults | |||||
| REF 5 | ClinicalTrials.gov (NCT04276688) Lopinavir/ Ritonavir, Ribavirin and IFN-beta Combination for nCoV Treatment | |||||
| REF 6 | ClinicalTrials.gov (NCT03891420) A Study to Evaluate the Safety, Pharmacokinetics and Antiviral Effects of Galidesivir in Yellow Fever or COVID-19. U.S. National Institutes of Health. | |||||
| REF 7 | Arsenicals (Melarsoprol), Pentamidine and Suramin in the Treatment of Human African Trypanosomiasis. Parasitol Res. 2003 May;90(1):71-9. | |||||
| REF 8 | Favipiravir versus Arbidol for COVID-19: A Randomized Clinical Trial. medRxiv. Posted April 15, 2020. | |||||
| REF 9 | Therapeutic options for the 2019 novel coronavirus (2019-nCoV). Nat Rev Drug Discov. 2020 Mar;19(3):149-150. | |||||
| REF 10 | Remdesivir and chloroquine effectively inhibit the recently emerged novel coronavirus (2019-nCoV) in vitro. Cell Res. 2020 Mar;30(3):269-271. | |||||
| REF 11 | BioCryst Begins Clinical Trial with Galidesivir for Treatment of Patients with COVID-19 | |||||
| REF 12 | Suramin, Penciclovir and Anidulafungin bind nsp12, which governs the RNA-dependent-RNA polymerase activity of SARS-CoV-2, with higher interaction energy than Remdesivir, indicating potential in the treatment of Covid-19 infection. April.21.2020. Doi: 10.31219/osf.io/urxwh | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.