Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T68066
|
|||||
| Target Name |
Steroid hormone receptor ERR (ESRR)
|
|||||
| Synonyms |
Nuclear receptor subfamily 3 group B; NR3B; ERR
Click to Show/Hide
|
|||||
| Gene Name |
ESRRA; ESRRB; ESRRG
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 9 Target-related Diseases | + | ||||
| 1 | Asthma [ICD-11: CA23] | |||||
| 2 | Atopic eczema [ICD-11: EA80] | |||||
| 3 | Contact dermatitis [ICD-11: EK00-EK0Z] | |||||
| 4 | Eyelid inflammatory disorder [ICD-11: 9A02] | |||||
| 5 | Inflammatory arthropathy [ICD-11: FA2Z] | |||||
| 6 | Postoperative inflammation [ICD-11: 1A00-CA43] | |||||
| 7 | Skin disease [ICD-11: EA00-EM0Z] | |||||
| 8 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| 9 | Vasomotor/allergic rhinitis [ICD-11: CA08] | |||||
| Function |
Intracellular receptors (typically cytoplasmic or nuclear). Initiates signal transduction for steroid hormones which lead to changes in gene expression over a time period of hours to days
Click to Show/Hide
|
|||||
| BioChemical Class |
Nuclear hormone receptor
|
|||||
| UniProt ID | ||||||
| Sequence |
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP LAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL EYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA MMD Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 14 Approved Drugs | + | ||||
| 1 | Amcinonide | Drug Info | Approved | Inflammation | [2], [3] | |
| 2 | Auranofin | Drug Info | Approved | Inflammatory arthritis | [4], [5] | |
| 3 | Beclomethasone | Drug Info | Approved | Allergic rhinitis | [6] | |
| 4 | Cortisone Acetate | Drug Info | Approved | Solid tumour/cancer | [7] | |
| 5 | Desonide | Drug Info | Approved | Atopic dermatitis | [8], [9] | |
| 6 | Desoximetasone | Drug Info | Approved | Inflammation | [10], [11] | |
| 7 | Flumethasone Pivalate | Drug Info | Approved | Contact dermatitis | [12], [13] | |
| 8 | Fluocinonide | Drug Info | Approved | Inflammation | [14], [15] | |
| 9 | Flurandrenolide | Drug Info | Approved | Inflammation | [16], [17] | |
| 10 | Halcinonide | Drug Info | Approved | Skin disease | [7] | |
| 11 | Halobetasol Propionate | Drug Info | Approved | Inflammation | [18] | |
| 12 | Loteprednol Etabonate | Drug Info | Approved | Eye inflammation | [18], [19] | |
| 13 | Medrysone | Drug Info | Approved | Eye inflammation | [20], [21] | |
| 14 | Prednicarbate | Drug Info | Approved | Inflammation | [18], [22] | |
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | IDP-122 | Drug Info | Phase 3 | Plaque psoriasis | [23] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | Prednisolone sodium metazoate | Drug Info | Discontinued in Phase 2 | Inflammatory bowel disease | [24] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 15 Modulator drugs | + | ||||
| 1 | Amcinonide | Drug Info | [1] | |||
| 2 | Auranofin | Drug Info | [1] | |||
| 3 | Beclomethasone | Drug Info | [1] | |||
| 4 | Cortisone Acetate | Drug Info | [1] | |||
| 5 | Desonide | Drug Info | [1] | |||
| 6 | Desoximetasone | Drug Info | [1] | |||
| 7 | Flumethasone Pivalate | Drug Info | [1] | |||
| 8 | Fluocinonide | Drug Info | [1] | |||
| 9 | Flurandrenolide | Drug Info | [1] | |||
| 10 | Halcinonide | Drug Info | [1] | |||
| 11 | Halobetasol Propionate | Drug Info | [1] | |||
| 12 | Loteprednol Etabonate | Drug Info | [1] | |||
| 13 | Medrysone | Drug Info | [1] | |||
| 14 | Prednicarbate | Drug Info | [1] | |||
| 15 | Prednisolone sodium metazoate | Drug Info | [25] | |||
| Agonist | [+] 1 Agonist drugs | + | ||||
| 1 | IDP-122 | Drug Info | [23] | |||
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7060). | |||||
| REF 3 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 076065. | |||||
| REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6306). | |||||
| REF 5 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 018689. | |||||
| REF 6 | Wilson and Gisvold's textbook of organic medicinal and pharmaceutical chemistry. 2004, P353. By Charles Owens Wilson, John H. Block, Ole Gisvold, John Marlowe Beale. | |||||
| REF 7 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 8 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7066). | |||||
| REF 9 | Emerging drugs for ocular allergy. Expert Opin Emerg Drugs. 2005 Aug;10(3):505-20. | |||||
| REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7067). | |||||
| REF 11 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 073193. | |||||
| REF 12 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7075). | |||||
| REF 13 | Drug information of Flumethasone Pivalate, 2008. eduDrugs. | |||||
| REF 14 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7078). | |||||
| REF 15 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 019117. | |||||
| REF 16 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7606). | |||||
| REF 17 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 087203. | |||||
| REF 18 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
| REF 19 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7085). | |||||
| REF 20 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7086). | |||||
| REF 21 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016624. | |||||
| REF 22 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7605). | |||||
| REF 23 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008689) | |||||
| REF 25 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.