Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T16987
(Former ID: TTDR00212)
|
|||||
| Target Name |
Carbonic anhydrase XII (CA-XII)
|
|||||
| Synonyms |
Tumor antigen HOM-RCC-3.1.3; Carbonic anhydrase 12; Carbonate dehydratase XII
|
|||||
| Gene Name |
CA12
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Bacterial infection [ICD-11: 1A00-1C4Z] | |||||
| 2 | Seborrhoeic dermatitis [ICD-11: EA81] | |||||
| Function |
Reversible hydration of carbon dioxide.
Click to Show/Hide
|
|||||
| BioChemical Class |
Alpha-carbonic anhydrase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 4.2.1.1
|
|||||
| Sequence |
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| ADReCS ID | BADD_A00053 ; BADD_A00799 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 2 Approved Drugs | + | ||||
| 1 | Salicyclic acid | Drug Info | Approved | Seborrhoeic dermatitis | [2], [3], [4] | |
| 2 | Sulfamylon | Drug Info | Approved | Bacterial infection | [4], [5] | |
| Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
| 1 | Curcumin | Drug Info | Phase 3 | Solid tumour/cancer | [6], [7] | |
| 2 | Coumate | Drug Info | Phase 2 | Breast cancer | [8] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 107 Inhibitor drugs | + | ||||
| 1 | Salicyclic acid | Drug Info | [9] | |||
| 2 | Sulfamylon | Drug Info | [1] | |||
| 3 | Curcumin | Drug Info | [10] | |||
| 4 | PARABEN | Drug Info | [11] | |||
| 5 | PHENOL | Drug Info | [10] | |||
| 6 | Coumate | Drug Info | [12] | |||
| 7 | FERULIC ACID | Drug Info | [11] | |||
| 8 | 1,4-Dihydro-1-methyl-4-oxo-3-pyridinesulfonamide | Drug Info | [13] | |||
| 9 | 1-Benzyl-1,4-dihydro-4-oxo-3-pyridinesulfonamide | Drug Info | [13] | |||
| 10 | 2,2,2-Trifluoro-N-(4-sulfamoyl-phenyl)-acetamide | Drug Info | [14] | |||
| 11 | 2,2-Dimethyl-N-(4-sulfamoyl-phenyl)-propionamide | Drug Info | [14] | |||
| 12 | 2,3-dihydro-1H-indene-5-sulfonamide | Drug Info | [15] | |||
| 13 | 2,4-Disulfamyltrifluoromethylaniline | Drug Info | [16] | |||
| 14 | 2-acetamido-2,3-dihydro-1H-indene-5-sulfonic acid | Drug Info | [15] | |||
| 15 | 2-amino-2,3-dihydro-1H-indene-5-sulfonamide | Drug Info | [15] | |||
| 16 | 2-Amino-benzenesulfonamide | Drug Info | [16] | |||
| 17 | 2-Amino-indan-5-sulfonic acid | Drug Info | [15] | |||
| 18 | 2-hydrazinylbenzenesulfonamide | Drug Info | [16] | |||
| 19 | 2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [17] | |||
| 20 | 2-oxo-2H-thiochromene-3-carboxylic acid | Drug Info | [17] | |||
| 21 | 3-((4-aminophenyl)diazenyl)benzenesulfonamide | Drug Info | [18] | |||
| 22 | 3-((4-hydroxyphenyl)diazenyl)benzenesulfonamide | Drug Info | [18] | |||
| 23 | 3-(3-Phenyl-ureido)-benzenesulfonamide | Drug Info | [14] | |||
| 24 | 3-(4'-Hydroxyphenyl)diazenylbenzenesulfonamide | Drug Info | [18] | |||
| 25 | 3-Amino-benzenesulfonamide | Drug Info | [19] | |||
| 26 | 4,4'-thiodipyridine-3-sulfonamide | Drug Info | [20] | |||
| 27 | 4-((4-hydroxyphenyl)diazenyl)benzenesulfonamide | Drug Info | [18] | |||
| 28 | 4-(2-AMINOETHYL)BENZENESULFONAMIDE | Drug Info | [16] | |||
| 29 | 4-(2-Hydroxy-ethyl)-benzenesulfonamide | Drug Info | [16] | |||
| 30 | 4-(2-Methyl-8-quinolinoxy)-3-pyridinesulfonamide | Drug Info | [20] | |||
| 31 | 4-(2-Propynylthio)pyridine-3-sulfonamide | Drug Info | [20] | |||
| 32 | 4-(4'-N-Methylphenyl)diazenylbenzenesulfonamide | Drug Info | [18] | |||
| 33 | 4-(4-Cyanophenoxy)-3-pyridinesulfonamide | Drug Info | [20] | |||
| 34 | 4-(4-Fluorophenoxy)-3-pyridinesulfonamide | Drug Info | [20] | |||
| 35 | 4-(5-Methyl-2-pirazolino)-3-pyridinesulfonamide | Drug Info | [20] | |||
| 36 | 4-(Allylamino)-3-pyridinesulfonamide | Drug Info | [20] | |||
| 37 | 4-(Carbamolymethylthio)pyridine-3-sulfonamide | Drug Info | [20] | |||
| 38 | 4-(Cyanomethylthio)pyridine-3-sulfonamide | Drug Info | [20] | |||
| 39 | 4-(hydroxymethyl)benzenesulfonamide | Drug Info | [16] | |||
| 40 | 4-(Methylhydrazino)-3-pyridinesulfonamide | Drug Info | [20] | |||
| 41 | 4-(N-Methyl-hydrazino)-benzenesulfonamide | Drug Info | [16] | |||
| 42 | 4-(N-Oxide-2-pyridylthio)pyridine-3-sulfonamide | Drug Info | [20] | |||
| 43 | 4-(Quinolinoxy)-3-pyridinesulfonamide | Drug Info | [20] | |||
| 44 | 4-Amino-3-bromo-benzenesulfonamide | Drug Info | [16] | |||
| 45 | 4-Amino-3-chloro-benzenesulfonamide | Drug Info | [16] | |||
| 46 | 4-Amino-3-fluoro-benzenesulfonamide | Drug Info | [16] | |||
| 47 | 4-Amino-3-iodo-benzenesulfonamide | Drug Info | [16] | |||
| 48 | 4-Benzenesulfonylamino-benzenesulfonamide | Drug Info | [14] | |||
| 49 | 4-Benzythiopyridine-3-sulfonamide | Drug Info | [20] | |||
| 50 | 4-CYANOPHENOL | Drug Info | [9] | |||
| 51 | 4-Ethoxy-3-pyridinesulfonamide | Drug Info | [20] | |||
| 52 | 4-Hydrazino-3-pyridinesulfonamide | Drug Info | [20] | |||
| 53 | 4-Hydrazino-benzenesulfonamide | Drug Info | [19] | |||
| 54 | 4-Methanesulfonylamino-benzenesulfonamide | Drug Info | [14] | |||
| 55 | 4-Methoxy-3-pyridinesulfonamide | Drug Info | [20] | |||
| 56 | 4-Methylamino-benzenesulfonamide | Drug Info | [16] | |||
| 57 | 4-Methylthiopyridine-3-sulfonamide | Drug Info | [20] | |||
| 58 | 4-[2-(3-Phenyl-ureido)-ethyl]-benzenesulfonamide | Drug Info | [14] | |||
| 59 | 6-(aminomethyl)-2H-chromen-2-one | Drug Info | [17] | |||
| 60 | 6-(hydroxymethyl)-2H-chromen-2-one | Drug Info | [17] | |||
| 61 | 6-Hydroxy-benzothiazole-2-sulfonic acid amide | Drug Info | [16] | |||
| 62 | 6-methoxy-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [17] | |||
| 63 | 6-methyl-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [17] | |||
| 64 | 7-(benzyloxy)-2H-chromen-2-one | Drug Info | [17] | |||
| 65 | 7-butoxy-2H-chromen-2-one | Drug Info | [17] | |||
| 66 | 7-methoxy-2-oxo-2H-chromene-4-carboxylic acid | Drug Info | [17] | |||
| 67 | 7-phenethoxy-2H-chromen-2-one | Drug Info | [17] | |||
| 68 | 7-propoxy-2H-chromen-2-one | Drug Info | [17] | |||
| 69 | 8-methoxy-2-oxo-2H-chromene-3-carboxylic acid | Drug Info | [17] | |||
| 70 | ACETYLSULFANILAMIDE | Drug Info | [14] | |||
| 71 | BENZOLAMIDE | Drug Info | [16] | |||
| 72 | Carzenide | Drug Info | [16] | |||
| 73 | CATECHIN | Drug Info | [10] | |||
| 74 | CATECHOL | Drug Info | [11] | |||
| 75 | CL-5343 | Drug Info | [21] | |||
| 76 | COUMARIN | Drug Info | [17] | |||
| 77 | Decane-1,10-diyl disulfamate | Drug Info | [22] | |||
| 78 | Decyl sulfamate | Drug Info | [22] | |||
| 79 | ELLAGIC ACID | Drug Info | [11] | |||
| 80 | ETHOXYCOUMARIN | Drug Info | [17] | |||
| 81 | Ethyl 7-methoxy-2-oxo-2H-chromene-3-carboxylate | Drug Info | [17] | |||
| 82 | GALLICACID | Drug Info | [11] | |||
| 83 | HERNIARIN | Drug Info | [17] | |||
| 84 | Hexane-1,6-diamine | Drug Info | [23] | |||
| 85 | N-(4-cyanophenyl)sulfamide | Drug Info | [24] | |||
| 86 | N-(4-Sulfamoyl-phenyl)-benzamide | Drug Info | [14] | |||
| 87 | N-(4-Sulfamoyl-phenyl)-butyramide | Drug Info | [14] | |||
| 88 | N-(4-Sulfamoyl-phenyl)-isobutyramide | Drug Info | [14] | |||
| 89 | N-(4-Sulfamoyl-phenyl)-propionamide | Drug Info | [14] | |||
| 90 | N-(pentafluorophenyl)sulfamide | Drug Info | [24] | |||
| 91 | N-hydroxysulfamide | Drug Info | [25] | |||
| 92 | N-propynyl amidebenzenesulphonide | Drug Info | [26] | |||
| 93 | N1-(2-aminoethyl)ethane-1,2-diamine | Drug Info | [23] | |||
| 94 | N1-(naphthalen-1-yl)ethane-1,2-diamine | Drug Info | [23] | |||
| 95 | Octane-1,8-diyl disulfamate | Drug Info | [22] | |||
| 96 | Octyl sulfamate | Drug Info | [22] | |||
| 97 | P-Coumaric Acid | Drug Info | [11] | |||
| 98 | P-toluenesulfonamide | Drug Info | [16] | |||
| 99 | Pentane-1,5-diamine | Drug Info | [23] | |||
| 100 | Pentanoic acid (4-sulfamoyl-phenyl)-amide | Drug Info | [14] | |||
| 101 | Prop-2-ynyl 4-sulfamoylbenzoate | Drug Info | [26] | |||
| 102 | RESORCINOL | Drug Info | [9] | |||
| 103 | SACCHARIN | Drug Info | [27] | |||
| 104 | Sodium N-methylphenylaminomethanesulfonate | Drug Info | [18] | |||
| 105 | Sodium phenylaminomethanesulfonate | Drug Info | [18] | |||
| 106 | Syringic Acid | Drug Info | [11] | |||
| 107 | Thioureido sulfonamide | Drug Info | [28] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
| 1 | Nitrogen metabolism | |||||
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | TGF_beta_Receptor Signaling Pathway | |||||
| Reactome | [+] 1 Reactome Pathways | + | ||||
| 1 | Reversible hydration of carbon dioxide | |||||
| WikiPathways | [+] 4 WikiPathways | + | ||||
| 1 | Reversible Hydration of Carbon Dioxide | |||||
| 2 | miR-targeted genes in muscle cell - TarBase | |||||
| 3 | miR-targeted genes in leukocytes - TarBase | |||||
| 4 | miR-targeted genes in epithelium - TarBase | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Sulfonamide linked neoglycoconjugates--a new class of inhibitors for cancer-associated carbonic anhydrases. J Med Chem. 2010 Apr 8;53(7):2913-26. | |||||
| REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4306). | |||||
| REF 3 | Drug information of Salicyclic acid, 2008. eduDrugs. | |||||
| REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 5 | ClinicalTrials.gov (NCT00634166) Prospective Evaluation of the Effects of Topical Therapy With Sulfamylon For 5% Topical Solution on Autograft Healing in Subjects With Thermal Injuries Requiring Meshed Autografts: A Comparison to a Historical Control Group. U.S. National Institutes of Health. | |||||
| REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7000). | |||||
| REF 7 | Nanocurcumin: a promising therapeutic advancement over native curcumin. Crit Rev Ther Drug Carrier Syst. 2013;30(4):331-68. | |||||
| REF 8 | Irosustat: a first-generation steroid sulfatase inhibitor in breast cancer. Expert Rev Anticancer Ther. 2011 Feb;11(2):179-83. | |||||
| REF 9 | Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. Bioorg Med Chem. 2008 Aug 1;16(15):7424-8. | |||||
| REF 10 | Carbonic anhydrase inhibitors. Antioxidant polyphenols effectively inhibit mammalian isoforms I-XV. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5050-3. | |||||
| REF 11 | Carbonic anhydrase inhibitors. Inhibition of mammalian isoforms I-XIV with a series of natural product polyphenols and phenolic acids. Bioorg Med Chem. 2010 Mar 15;18(6):2159-2164. | |||||
| REF 12 | Carbonic anhydrase inhibitors. Interaction of the antitumor sulfamate EMD 486019 with twelve mammalian carbonic anhydrase isoforms: Kinetic and X-r... Bioorg Med Chem Lett. 2008 Aug 1;18(15):4282-6. | |||||
| REF 13 | Carbonic anhydrase inhibitors. Regioselective synthesis of novel 1-substituted 1,4-dihydro-4-oxo-3-pyridinesulfonamides and their inhibition of the... Eur J Med Chem. 2010 Sep;45(9):3656-61. | |||||
| REF 14 | Carbonic anhydrase inhibitors: inhibition of the tumor-associated isozymes IX and XII with a library of aromatic and heteroaromatic sulfonamides. Bioorg Med Chem Lett. 2005 Nov 1;15(21):4862-6. | |||||
| REF 15 | Indanesulfonamides as carbonic anhydrase inhibitors and anticonvulsant agents: structure-activity relationship and pharmacological evaluation. Eur J Med Chem. 2008 Dec;43(12):2853-60. | |||||
| REF 16 | Carbonic anhydrase inhibitors. Inhibition of the transmembrane isozyme XII with sulfonamides-a new target for the design of antitumor and antiglauc... Bioorg Med Chem Lett. 2005 Feb 15;15(4):963-9. | |||||
| REF 17 | Deciphering the mechanism of carbonic anhydrase inhibition with coumarins and thiocoumarins. J Med Chem. 2010 Jan 14;53(1):335-44. | |||||
| REF 18 | Carbonic anhydrase inhibitors. Diazenylbenzenesulfonamides are potent and selective inhibitors of the tumor-associated isozymes IX and XII over the... Bioorg Med Chem. 2009 Oct 15;17(20):7093-9. | |||||
| REF 19 | Carbonic anhydrase inhibitors: inhibition of the transmembrane isozyme XIV with sulfonamides. Bioorg Med Chem Lett. 2005 Sep 1;15(17):3828-33. | |||||
| REF 20 | Carbonic anhydrase inhibitors: synthesis and inhibition of the human cytosolic isozymes I and II and transmembrane isozymes IX, XII (cancer-associa... Eur J Med Chem. 2010 Jun;45(6):2396-404. | |||||
| REF 21 | Carbonic anhydrase inhibitors. The X-ray crystal structure of human isoform II in adduct with an adamantyl analogue of acetazolamide resides in a l... Bioorg Med Chem Lett. 2010 Aug 1;20(15):4376-81. | |||||
| REF 22 | Carbonic anhydrase inhibitors. Comparison of aliphatic sulfamate/bis-sulfamate adducts with isozymes II and IX as a platform for designing tight-bi... J Med Chem. 2009 Oct 8;52(19):5990-8. | |||||
| REF 23 | Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. J Med Chem. 2010 Aug 12;53(15):5511-22. | |||||
| REF 24 | Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, IX, and XII with N-hydroxy... Bioorg Med Chem Lett. 2005 May 2;15(9):2353-8. | |||||
| REF 25 | Carbonic anhydrase inhibitors: crystallographic and solution binding studies for the interaction of a boron-containing aromatic sulfamide with mamm... Bioorg Med Chem Lett. 2010 Jun 15;20(12):3601-5. | |||||
| REF 26 | Inhibition of membrane-associated carbonic anhydrase isozymes IX, XII and XIV with a library of glycoconjugate benzenesulfonamides. Bioorg Med Chem Lett. 2007 Feb 15;17(4):987-92. | |||||
| REF 27 | Carbonic anhydrase inhibitors: copper(II) complexes of polyamino-polycarboxylamido aromatic/heterocyclic sulfonamides are very potent inhibitors of... Bioorg Med Chem Lett. 2008 Jan 15;18(2):836-41. | |||||
| REF 28 | Carbonic anhydrase inhibitors: design of thioureido sulfonamides with potent isozyme II and XII inhibitory properties and intraocular pressure lowe... Bioorg Med Chem Lett. 2005 Sep 1;15(17):3821-7. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.