Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T56545 | Target Info | |||
Target Name | Apolipoprotein A-I (APOA1) | ||||
Synonyms | Truncated apolipoprotein AI; Apolipoprotein A1; ApoAI; ApoA-I; Apo-AI | ||||
Target Type | Clinical trial Target | ||||
Gene Name | APOA1 | ||||
Biochemical Class | Apolipoprotein | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | Retinoid X receptor alpha (RXR-A) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Retinoid X receptors | ||||
Regulation Type | Increase/Decrease | ||||
Regulation Mechanism | The C site is the negative FXRE in the human APOAI promoter to which FXR binds independently of RXR. | [1] | |||
Evidence Score (E-score) | 7 | + | |||
1 | Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay | [11] | |||
2 | Electrophoretic Mobility Shift Assay | [1] | |||
3 | Electrophoretic Mobility Shift Assay | [12] | |||
4 | Electrophoretic Mobility Shift Assay | [6] | |||
5 | Electrophoretic Mobility Shift Assay | [13] | |||
6 | Electrophoretic Mobility Shift Assay | [3] | |||
7 | Electrophoretic Mobility Shift Assay | [14] | |||
UniProt ID | |||||
Sequence |
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Acyltransferases | [+] 1 Acyltransferases Co-regulated By This TF | + | |||
1 | Carnitine O-palmitoyltransferase I (CPT1B) | Successful Target | Target Info | [18] | |
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [1] | |
2 | Apolipoprotein A-II (APOA2) | Literature-reported Target | Target Info | [19] | |
3 | Apolipoprotein C-III (ApoCIII) | Clinical trial Target | Target Info | [20] | |
4 | Apolipoprotein E (APOE) | Clinical trial Target | Target Info | [21] | |
Ester hydrolases | [+] 1 Ester hydrolases Co-regulated By This TF | + | |||
1 | Lipoprotein lipase (LPL) | Successful Target | Target Info | [22] | |
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
1 | Extracellular calcium-sensing receptor (CASR) | Successful Target | Target Info | [23] | |
Glycoproteins | [+] 2 Glycoproteins Co-regulated By This TF | + | |||
1 | Cholesteryl ester transfer protein (CETP) | Clinical trial Target | Target Info | [24] | |
2 | Phospholipid transfer protein (PLTP) | Literature-reported Target | Target Info | [25] | |
Kinases | [+] 1 Kinases Co-regulated By This TF | + | |||
1 | Epidermal growth factor receptor (EGFR) | Successful Target | Target Info | [26] | |
Mitochondrial carriers | [+] 1 Mitochondrial carriers Co-regulated By This TF | + | |||
1 | Mitochondrial uncoupling protein 3 (UCP3) | Clinical trial Target | Target Info | [27] | |
Nuclear hormone receptors | [+] 4 Nuclear hormone receptors Co-regulated By This TF | + | |||
1 | Hepatocyte nuclear factor 4-alpha (HNF4A) | Literature-reported Target | Target Info | [28] | |
2 | Retinoic acid receptor beta (RARB) | Successful Target | Target Info | [29] | |
3 | Retinoic acid receptor gamma (RARG) | Successful Target | Target Info | [30] | |
4 | Retinoic acid receptor RXR-gamma (RXRG) | Successful Target | Target Info | [31] | |
TF Name | Hepatocyte nuclear factor 4-alpha (HNF-4A) homodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Hepatocyte nuclear factor 4 | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | PZLHIVAI-4 contains four HNF4 response elements (site A) from the human APOAI gene inserted at the BamHI site immediately upstream of positions 57 to +80 of the human immunodeficiency virus long terminal repeat driving the firefly luciferase gene in pZLuc. | [2] | |||
Evidence Score (E-score) | 4 | + | |||
1 | Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay | [11] | |||
2 | Electrophoretic Mobility Shift Assay | [15] | |||
3 | Electrophoretic Mobility Shift Assay | [16] | |||
4 | Luciferase Reporter Assay | [2] | |||
UniProt ID | |||||
Sequence |
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [2] | |
2 | Apolipoprotein A-II (APOA2) | Literature-reported Target | Target Info | [32] | |
3 | Apolipoprotein B-100 (APOB) | Clinical trial Target | Target Info | [33] | |
4 | Apolipoprotein C-III (ApoCIII) | Clinical trial Target | Target Info | [34] | |
Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
1 | Coagulation factor VIII (F8) | Successful Target | Target Info | [35] | |
Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
1 | Erythropoietin (EPO) | Clinical trial Target | Target Info | [36] | |
Nuclear hormone receptors | [+] 1 Nuclear hormone receptors Co-regulated By This TF | + | |||
1 | Hepatocyte nuclear factor 4-alpha (HNF4A) | Literature-reported Target | Target Info | [28] | |
Oxidoreductases | [+] 2 Oxidoreductases Co-regulated By This TF | + | |||
1 | Debrisoquine 4-hydroxylase (CYP2D6) | Successful Target | Target Info | [37] | |
2 | Heme oxygenase 1 (HMOX1) | Clinical trial Target | Target Info | [38] | |
Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
1 | Coagulation factor IX (F9) | Successful Target | Target Info | [39] | |
Serpin proteins | [+] 1 Serpin proteins Co-regulated By This TF | + | |||
1 | Angiotensinogen (AGT) | Literature-reported Target | Target Info | [40] | |
Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
1 | Transferrin (TF) | Clinical trial Target | Target Info | [41] | |
TF Name | Retinoic acid receptor alpha (RAR-A) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Retinoic acid receptors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Several members of the nuclear receptor superfamily including RXR (retinoid X receptor) bind to a specific RAR element (site A) of theAPOAIpromoter. | [3] | |||
Evidence Score (E-score) | 3 | + | |||
1 | Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay | [11] | |||
2 | Electrophoretic Mobility Shift Assay | [3] | |||
3 | Electrophoretic Mobility Shift Assay | [14] | |||
UniProt ID | |||||
Sequence |
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 2 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [3] | |
2 | Apolipoprotein C-III (ApoCIII) | Clinical trial Target | Target Info | [42] | |
Growth factors | [+] 1 Growth factors Co-regulated By This TF | + | |||
1 | Thrombomodulin (THBD) | Discontinued Target | Target Info | [43] | |
Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
1 | Insulin (INS) | Successful Target | Target Info | [44] | |
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
1 | Intercellular adhesion molecule ICAM-1 (ICAM1) | Successful Target | Target Info | [45] | |
Mitochondrial carriers | [+] 1 Mitochondrial carriers Co-regulated By This TF | + | |||
1 | Mitochondrial uncoupling protein 3 (UCP3) | Clinical trial Target | Target Info | [27] | |
Nuclear hormone receptors | [+] 3 Nuclear hormone receptors Co-regulated By This TF | + | |||
1 | Hepatocyte nuclear factor 4-alpha (HNF4A) | Literature-reported Target | Target Info | [28] | |
2 | Retinoic acid receptor beta (RARB) | Successful Target | Target Info | [46] | |
3 | Retinoic acid receptor gamma (RARG) | Successful Target | Target Info | [30] | |
TF Name | COUP transcription factor 1 (COUP-TF1) homodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Evidence Score (E-score) | 3 | + | |||
1 | Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay | [11] | |||
2 | DNase I Footprint Analysis, Electrophoretic Mobility Shift Assay | [5] | |||
3 | Electrophoretic Mobility Shift Assay | [4] | |||
UniProt ID | |||||
Sequence |
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGA
PATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTY TCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLN GHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFF PDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIR IFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQY PNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSI QCS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [4] | |
2 | Apolipoprotein A-II (APOA2) | Literature-reported Target | Target Info | [32] | |
3 | Apolipoprotein B-100 (APOB) | Clinical trial Target | Target Info | [47] | |
4 | Apolipoprotein C-III (ApoCIII) | Clinical trial Target | Target Info | [48] | |
Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
1 | Erythropoietin (EPO) | Clinical trial Target | Target Info | [36] | |
TF Name | Forkhead box protein A2 (FOXA2) | ||||
Classification | Superclass | Helix-turn-helix | |||
Class | Fork head / winged helix | ||||
Family | Tissue-specific regulators | ||||
Regulation Type | Increase | ||||
Evidence Score (E-score) | 3 | + | |||
1 | Electrophoretic Mobility Shift Assay | [4] | |||
2 | Electrophoretic Mobility Shift Assay | [13] | |||
3 | Electrophoretic Mobility Shift Assay | [17] | |||
UniProt ID | |||||
Sequence |
MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSA
GSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGA MGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKML TLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSG NMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQASQAQLGEAAGPASETPAG TESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPP EAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPG SLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 2 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [4] | |
2 | Apolipoprotein B-100 (APOB) | Clinical trial Target | Target Info | [33] | |
Growth factor binding | [+] 1 Growth factor binding Co-regulated By This TF | + | |||
1 | Insulin-like growth factor-binding protein 1 (IGFBP1) | Literature-reported Target | Target Info | [49] | |
TF Name | COUP transcription factor 2 (COUP-TF2) homodimer | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Regulation Mechanism | Site A in the apoAI promoter has been previously shown to bind various members of the steroid/thyroid hormone receptor superfamily such as RXRa, RARa, RAR/3, Arp-l, Ear3/COUP-TF, and HNF-4. | [5] | |||
Evidence Score (E-score) | 2 | + | |||
1 | Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay | [11] | |||
2 | DNase I Footprint Analysis, Electrophoretic Mobility Shift Assay | [5] | |||
UniProt ID | |||||
Sequence |
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 4 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [5] | |
2 | Apolipoprotein A-II (APOA2) | Literature-reported Target | Target Info | [32] | |
3 | Apolipoprotein B-100 (APOB) | Clinical trial Target | Target Info | [47] | |
4 | Apolipoprotein C-III (ApoCIII) | Clinical trial Target | Target Info | [48] | |
Glycoproteins | [+] 1 Glycoproteins Co-regulated By This TF | + | |||
1 | Cholesteryl ester transfer protein (CETP) | Clinical trial Target | Target Info | [50] | |
Nuclear hormone receptors | [+] 1 Nuclear hormone receptors Co-regulated By This TF | + | |||
1 | Hepatocyte nuclear factor 4-alpha (HNF4A) | Literature-reported Target | Target Info | [28] | |
TF Name | Retinoic acid receptor beta (RAR-B) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Family | Thyroid hormone receptor-like factors | ||||
Subfamily | Retinoic acid receptors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Transcription factors bound to three separate sites of the APOAI gene, including site A (-214 to -192). Site A is a highly selective retinoic acid-responsive element (RARE) that responds preferentially to the recently identified retinoic acid receptor RAR. | [6] | |||
Evidence Score (E-score) | 2 | + | |||
1 | Electrophoretic Mobility Shift Assay | [6] | |||
2 | Electrophoretic Mobility Shift Assay | [3] | |||
UniProt ID | |||||
Sequence |
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEM TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV EFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALK IYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH EPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [6] | |
Growth factors | [+] 1 Growth factors Co-regulated By This TF | + | |||
1 | Thrombomodulin (THBD) | Discontinued Target | Target Info | [43] | |
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
1 | Intercellular adhesion molecule ICAM-1 (ICAM1) | Successful Target | Target Info | [45] | |
Nuclear hormone receptors | [+] 2 Nuclear hormone receptors Co-regulated By This TF | + | |||
1 | Retinoic acid receptor beta (RARB) | Successful Target | Target Info | [46] | |
2 | Retinoic acid receptor gamma (RARG) | Successful Target | Target Info | [30] | |
TF Name | Forkhead box protein A1 (FOXA1) | ||||
Classification | Superclass | Helix-turn-helix | |||
Class | Fork head / winged helix | ||||
Family | Tissue-specific regulators | ||||
Regulation Type | Increase | ||||
Evidence Score (E-score) | 2 | + | |||
1 | Electrophoretic Mobility Shift Assay | [4] | |||
2 | Electrophoretic Mobility Shift Assay | [7] | |||
UniProt ID | |||||
Sequence |
MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMT
PASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQ AASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLIT MAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGK GSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGA SNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPI SSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 3 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [4] | |
2 | Apolipoprotein B-100 (APOB) | Clinical trial Target | Target Info | [51] | |
3 | Apolipoprotein E (APOE) | Clinical trial Target | Target Info | [52] | |
Growth factor binding | [+] 1 Growth factor binding Co-regulated By This TF | + | |||
1 | Insulin-like growth factor-binding protein 1 (IGFBP1) | Literature-reported Target | Target Info | [49] | |
TF Name | Forkhead box protein A3 (FOXA3) | ||||
Classification | Superclass | Helix-turn-helix | |||
Class | Fork head / winged helix | ||||
Family | Tissue-specific regulators | ||||
Regulation Type | Increase | ||||
Evidence Score (E-score) | 2 | + | |||
1 | Electrophoretic Mobility Shift Assay | [7] | |||
2 | Electrophoretic Mobility Shift Assay | [14] | |||
UniProt ID | |||||
Sequence |
MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPL
PSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPY SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVAR SPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAAST TTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNF NHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 2 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [7] | |
2 | Apolipoprotein B-100 (APOB) | Clinical trial Target | Target Info | [51] | |
TF Name | Early growth response protein 1 (EGR1) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys2His2 zinc finger domain | ||||
Family | Developmental / cell cycle regulators | ||||
Subfamily | Egr/Krox | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | SP1 in HepG2 nuclear extracts bound to EGR1 binding sites. Mutations that prevent EGR1 binding to the APOAI enhancer abolished its responsiveness to Erg-1, while they had only minor effects on its constitutive activity. | [8] | |||
Evidence Score (E-score) | 1 | + | |||
1 | Electrophoretic Mobility Shift Assay | [8] | |||
UniProt ID | |||||
Sequence |
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI EIC |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [8] | |
Growth factors | [+] 2 Growth factors Co-regulated By This TF | + | |||
1 | Platelet-derived growth factor A (PDGFA) | Clinical trial Target | Target Info | [53] | |
2 | Platelet-derived growth factor B (PDGFB) | Clinical trial Target | Target Info | [54] | |
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
1 | B-lymphocyte surface antigen B4 (CD19) | Successful Target | Target Info | [55] | |
Kinases | [+] 1 Kinases Co-regulated By This TF | + | |||
1 | Epidermal growth factor receptor (EGFR) | Successful Target | Target Info | [56] | |
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
1 | Superoxide dismutase Cu-Zn (SOD Cu-Zn) | Clinical trial Target | Target Info | [57] | |
Transcription factors | [+] 2 Transcription factors Co-regulated By This TF | + | |||
1 | Cellular tumor antigen p53 (TP53) | Clinical trial Target | Target Info | [58] | |
2 | Early growth response protein 1 (EGR-1) | Clinical trial Target | Target Info | [59] | |
TF Name | Nuclear transcription factor Y A/B/C (NF-Y) heterotrimer | ||||
Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
Class | Heteromeric CCAAT factors | ||||
Family | Heteromeric CCAAT factors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | NF-Ytranscription factor binds to regulatory element AIC and transactivates the human APOAIpromoterin HEPG2 cells. | [9] | |||
Evidence Score (E-score) | 1 | + | |||
1 | Electrophoretic Mobility Shift Assay | [9] | |||
UniProt ID | |||||
Sequence |
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV QVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL QQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMV PGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLH ESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [9] | |
Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
1 | Coagulation factor VIII (F8) | Successful Target | Target Info | [60] | |
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Apoptosis mediating surface antigen FAS (FAS) | Clinical trial Target | Target Info | [31] | |
2 | Interleukin-4 (IL4) | Clinical trial Target | Target Info | [61] | |
Ester hydrolases | [+] 1 Ester hydrolases Co-regulated By This TF | + | |||
1 | M-phase inducer phosphatase 3 (MPIP3) | Literature-reported Target | Target Info | [62] | |
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
1 | Catalase (CAT) | Clinical trial Target | Target Info | [63] | |
TF Name | Sp1 transcription factor (SP1) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys2His2 zinc finger domain | ||||
Family | Ubiquitous factors | ||||
Regulation Mechanism | SP1 in HepG2 nuclear extracts bound to EGR1 binding sites. Mutations that prevent EGR1 binding to the APOAI enhancer abolished its responsiveness to Erg-1, while they had only minor effects on its constitutive activity. | [8] | |||
Evidence Score (E-score) | 1 | + | |||
1 | Electrophoretic Mobility Shift Assay | [8] | |||
UniProt ID | |||||
Sequence |
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSP
LALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTS KEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQ TVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQG LANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVT SGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVS GLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPL SGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQ TITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTS GIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTR REACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTW SYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALS VGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINI SGNGF |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Acyltransferases | [+] 2 Acyltransferases Co-regulated By This TF | + | |||
1 | Glutathione S-transferase P (GSTP1) | Clinical trial Target | Target Info | [64] | |
2 | Lecithin-cholesterol acyltransferase (LCAT) | Clinical trial Target | Target Info | [65] | |
Apolipoproteins | [+] 2 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [8] | |
2 | Apolipoprotein E (APOE) | Clinical trial Target | Target Info | [66] | |
Apoptosis regulators | [+] 1 Apoptosis regulators Co-regulated By This TF | + | |||
1 | Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1) | Clinical trial Target | Target Info | [67] | |
Carbon-nitrogen hydrolases | [+] 1 Carbon-nitrogen hydrolases Co-regulated By This TF | + | |||
1 | Adenosine deaminase (ADA) | Successful Target | Target Info | [68] | |
Caveolin proteins | [+] 1 Caveolin proteins Co-regulated By This TF | + | |||
1 | Caveolin 1 (CAV1) | Literature-reported Target | Target Info | [69] | |
Collagens | [+] 1 Collagens Co-regulated By This TF | + | |||
1 | Collagen I (COL1A2) | Clinical trial Target | Target Info | [70] | |
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Erythropoietin Receptor (EPOR) | Successful Target | Target Info | [71] | |
2 | Interferon-gamma (IFNG) | Successful Target | Target Info | [72] | |
Ester hydrolases | [+] 2 Ester hydrolases Co-regulated By This TF | + | |||
1 | Acetylcholinesterase (AChE) | Successful Target | Target Info | [73] | |
2 | M-phase inducer phosphatase 3 (MPIP3) | Literature-reported Target | Target Info | [62] | |
G protein-coupled receptors | [+] 3 G protein-coupled receptors Co-regulated By This TF | + | |||
1 | 5-HT 1A receptor (HTR1A) | Successful Target | Target Info | [74] | |
2 | C-X-C chemokine receptor type 4 (CXCR4) | Successful Target | Target Info | [75] | |
3 | Thromboxane A2 receptor (TBXA2R) | Successful Target | Target Info | [76] | |
Glycoproteins | [+] 2 Glycoproteins Co-regulated By This TF | + | |||
1 | Cholesteryl ester transfer protein (CETP) | Clinical trial Target | Target Info | [50] | |
2 | Tracheobronchial mucin 5A (MUC5AC) | Literature-reported Target | Target Info | [27] | |
Growth factors | [+] 4 Growth factors Co-regulated By This TF | + | |||
1 | Platelet-derived growth factor A (PDGFA) | Clinical trial Target | Target Info | [53] | |
2 | Platelet-derived growth factor B (PDGFB) | Clinical trial Target | Target Info | [77] | |
3 | Thrombomodulin (THBD) | Discontinued Target | Target Info | [43] | |
4 | Transforming growth factor beta 1 (TGFB1) | Successful Target | Target Info | [78] | |
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
1 | Intercellular adhesion molecule ICAM-1 (ICAM1) | Successful Target | Target Info | [79] | |
Integrins | [+] 1 Integrins Co-regulated By This TF | + | |||
1 | Integrin alpha-2 (ITGA2) | Clinical trial Target | Target Info | [80] | |
Kinases | [+] 5 Kinases Co-regulated By This TF | + | |||
1 | Casein kinase II alpha (CSNK2A1) | Clinical trial Target | Target Info | [81] | |
2 | Epidermal growth factor receptor (EGFR) | Successful Target | Target Info | [82] | |
3 | Serine/threonine-protein kinase pim-1 (PIM1) | Clinical trial Target | Target Info | [83] | |
4 | Telomerase reverse transcriptase (TERT) | Clinical trial Target | Target Info | [84] | |
5 | Thymidine kinase 1 (TK1) | Successful Target | Target Info | [85] | |
Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
1 | Low-density lipoprotein receptor (LDL-R) | Successful Target | Target Info | [86] | |
Lyases | [+] 2 Lyases Co-regulated By This TF | + | |||
1 | Histidine decarboxylase (HDC) | Clinical trial Target | Target Info | [87] | |
2 | Leukotriene C4 synthase (LTC4S) | Patented-recorded Target | Target Info | [88] | |
Nuclear hormone receptors | [+] 2 Nuclear hormone receptors Co-regulated By This TF | + | |||
1 | Hepatocyte nuclear factor 4-alpha (HNF4A) | Literature-reported Target | Target Info | [28] | |
2 | Progesterone receptor (PGR) | Successful Target | Target Info | [89] | |
Oxidoreductases | [+] 9 Oxidoreductases Co-regulated By This TF | + | |||
1 | Arachidonate 12-lipoxygenase (12-LOX) | Literature-reported Target | Target Info | [90] | |
2 | Bacterial Triosephosphate isomerase (Bact TPI) | Literature-reported Target | Target Info | [91] | |
3 | Catalase (CAT) | Clinical trial Target | Target Info | [63] | |
4 | Cholesterol desmolase (CYP11A1) | Successful Target | Target Info | [92] | |
5 | Dopamine beta hydroxylase (DBH) | Clinical trial Target | Target Info | [93] | |
6 | Estradiol 17 beta-dehydrogenase 1 (17-beta-HSD1) | Clinical trial Target | Target Info | [94] | |
7 | Heme oxygenase 1 (HMOX1) | Clinical trial Target | Target Info | [38] | |
8 | Nitric-oxide synthase endothelial (NOS3) | Clinical trial Target | Target Info | [95] | |
9 | Superoxide dismutase Cu-Zn (SOD Cu-Zn) | Clinical trial Target | Target Info | [96] | |
Peptidases | [+] 4 Peptidases Co-regulated By This TF | + | |||
1 | Caspase-8 (CASP8) | Patented-recorded Target | Target Info | [97] | |
2 | Cathepsin D (CTSD) | Clinical trial Target | Target Info | [98] | |
3 | Dibasic-processing enzyme (Furin) | Preclinical Target | Target Info | [99] | |
4 | Neutral endopeptidase (MME) | Clinical trial Target | Target Info | [100] | |
Pro-neuropeptides | [+] 1 Pro-neuropeptides Co-regulated By This TF | + | |||
1 | Neuropeptide Y (NPY) | Literature-reported Target | Target Info | [101] | |
Small GTPases | [+] 1 Small GTPases Co-regulated By This TF | + | |||
1 | GTPase HRas (HRAS) | Literature-reported Target | Target Info | [102] | |
Somatotropin / Prolactins | [+] 1 Somatotropin / Prolactins Co-regulated By This TF | + | |||
1 | Somatotropin (GH1) | Clinical trial Target | Target Info | [103] | |
Transcription factors | [+] 2 Transcription factors Co-regulated By This TF | + | |||
1 | Transcription factor Sp1 (SP1) | Clinical trial Target | Target Info | [104] | |
2 | Wilms tumor protein (WT1) | Clinical trial Target | Target Info | [105] | |
Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
1 | Transferrin (TF) | Clinical trial Target | Target Info | [106] | |
Zinc-fingers | [+] 1 Zinc-fingers Co-regulated By This TF | + | |||
1 | Utrophin (UTRN) | Clinical trial Target | Target Info | [107] | |
TF Name | CCAAT/enhancer-binding protein (CEBP) homo/heterodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Leucine zipper factors (bZIP) | ||||
Family | C/EBP-like factors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | The heat-stable factors bind in the -175 to -148 region of APOA1 and can be distinguished from CEBP, which recognizes the same region, with DNA binding gel electrophoretic assays. | [10] | |||
Evidence Score (E-score) | 1 | + | |||
1 | Electrophoretic Mobility Shift Assay, DNase I Footprint Analysis | [10] | |||
UniProt ID | |||||
Sequence |
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [10] | |
Ester hydrolases | [+] 1 Ester hydrolases Co-regulated By This TF | + | |||
1 | Lipoprotein lipase (LPL) | Successful Target | Target Info | [108] | |
Growth factors | [+] 1 Growth factors Co-regulated By This TF | + | |||
1 | Insulin-like growth factor-II (IGF2) | Clinical trial Target | Target Info | [109] |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Bile acid-activated nuclear receptor FXR suppresses apolipoprotein A-I transcription via a negative FXR response element. J Clin Invest. 2002 Apr;109(7):961-71. | ||||
REF 2 | Modulation of transcriptional activation and coactivator interaction by a splicing variation in the F domain of nuclear receptor hepatocyte nuclear factor 4alpha1. Mol Cell Biol. 1999 Oct;19(10):6509-22. | ||||
REF 3 | Differential transcriptional regulation of the apoAI gene by retinoic acid receptor homo- and heterodimers in yeast. Nucleic Acids Res. 1996 Feb 15;24(4):566-72. | ||||
REF 4 | COUP orphan receptors are negative regulators of retinoic acid response pathways. Mol Cell Biol. 1992 Oct;12(10):4666-76. | ||||
REF 5 | Intestinal apolipoprotein AI gene transcription is regulated by multiple distinct DNA elements and is synergistically activated by the orphan nuclear receptor, hepatocyte nuclear factor 4. J Clin Invest. 1995 Jul;96(1):528-38. | ||||
REF 6 | A retinoic acid-responsive element in the apolipoprotein AI gene distinguishes between two different retinoic acid response pathways. Mol Cell Biol. 1991 Jul;11(7):3814-20. | ||||
REF 7 | Control of apolipoprotein AI gene expression through synergistic interactions between hepatocyte nuclear factors 3 and 4. J Biol Chem. 1996 Jun 7;271(23):13621-8. | ||||
REF 8 | Involvement of early growth response factor Egr-1 in apolipoprotein AI gene transcription. J Biol Chem. 1995 Mar 24;270(12):7004-10. | ||||
REF 9 | NFY transcription factor binds to regulatory element AIC and transactivates the human apolipoprotein A-I promoter in HEPG2 cells. Biochem Biophys Res Commun. 1997 Feb 3;231(1):140-3. | ||||
REF 10 | Promoter elements and factors involved in hepatic transcription of the human ApoA-I gene positive and negative regulators bind to overlapping sites. J Biol Chem. 1991 Mar 25;266(9):5790-7. | ||||
REF 11 | Binding specificity and modulation of the ApoA-I promoter activity by homo- and heterodimers of nuclear receptors. J Biol Chem. 1996 Apr 5;271(14):8402-15. | ||||
REF 12 | Repression by ARP-1 sensitizes apolipoprotein AI gene responsiveness to RXR alpha and retinoic acid. Mol Cell Biol. 1992 Aug;12(8):3380-9. | ||||
REF 13 | Exclusive homodimerization of the orphan receptor hepatocyte nuclear factor 4 defines a new subclass of nuclear receptors. Mol Cell Biol. 1995 Sep;15(9):5131-43. | ||||
REF 14 | E1A represses apolipoprotein AI enhancer activity in liver cells through a pRb- and CBP-independent pathway. Nucleic Acids Res. 1998 Apr 1;26(7):1761-8. | ||||
REF 15 | Characterization of an enhancer element in the human apolipoprotein C-III gene that regulates human apolipoprotein A-I gene expression in the intestinal epithelium. J Biol Chem. 1995 Aug 25;270(34):19979-88. | ||||
REF 16 | Utilization of recombinant adenovirus and dominant negative mutants to characterize hepatocyte nuclear factor 4-regulated apolipoprotein AI and CIII expression. J Biol Chem. 1997 May 23;272(21):13892-8. | ||||
REF 17 | TFIIB-directed transcriptional activation by the orphan nuclear receptor hepatocyte nuclear factor 4. Mol Cell Biol. 1996 Apr;16(4):1824-31. | ||||
REF 18 | Co-regulation of tissue-specific alternative human carnitine palmitoyltransferase Ibeta gene promoters by fatty acid enzyme substrate. J Biol Chem. 1998 Dec 4;273(49):32901-9. | ||||
REF 19 | Retinoids increase human apolipoprotein A-11 expression through activation of the retinoid X receptor but not the retinoic acid receptor. Mol Cell Biol. 1996 Jul;16(7):3350-60. | ||||
REF 20 | Mode of action of peroxisome proliferators as hypolipidemic drugs. Suppression of apolipoprotein C-III. J Biol Chem. 1995 Jun 2;270(22):13470-5. | ||||
REF 21 | LXRs control lipid-inducible expression of the apolipoprotein E gene in macrophages and adipocytes. Proc Natl Acad Sci U S A. 2001 Jan 16;98(2):507-12. | ||||
REF 22 | PPARalpha and PPARgamma activators direct a distinct tissue-specific transcriptional response via a PPRE in the lipoprotein lipase gene. EMBO J. 1996 Oct 1;15(19):5336-48. | ||||
REF 23 | Human calcium-sensing receptor gene. Vitamin D response elements in promoters P1 and P2 confer transcriptional responsiveness to 1,25-dihydroxyvitamin D. J Biol Chem. 2002 Aug 16;277(33):30337-50. | ||||
REF 24 | The orphan nuclear receptor LRH-1 potentiates the sterol-mediated induction of the human CETP gene by liver X receptor. J Biol Chem. 2001 Jul 6;276(27):24767-73. | ||||
REF 25 | The farnesoid X-activated receptor mediates bile acid activation of phospholipid transfer protein gene expression. J Biol Chem. 2000 Dec 15;275(50):39313-7. | ||||
REF 26 | T3 receptor suppression of Sp1-dependent transcription from the epidermal growth factor receptor promoter via overlapping DNA-binding sites. J Biol Chem. 1993 Jul 25;268(21):16065-73. | ||||
REF 27 | The human uncoupling protein-3 gene promoter requires MyoD and is induced by retinoic acid in muscle cells. FASEB J. 2000 Nov;14(14):2141-3. | ||||
REF 28 | Regulatory mechanisms controlling human hepatocyte nuclear factor 4alpha gene expression. Mol Cell Biol. 2001 Nov;21(21):7320-30. | ||||
REF 29 | Vitamin D represses retinoic acid-dependent transactivation of the retinoic acid receptor-beta2 promoter: the AF-2 domain of the vitamin D receptor is required for transrepression. Endocrinology. 1999 Jun;140(6):2898-907. | ||||
REF 30 | RAR gamma 2 expression is regulated through a retinoic acid response element embedded in Sp1 sites. Mol Cell Biol. 1992 Jul;12(7):2976-85. | ||||
REF 31 | Identification of thyroid hormone response elements in the human fatty acid synthase promoter. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12260-5. | ||||
REF 32 | Transcriptional regulation of human apolipoprotein genes ApoB, ApoCIII, and ApoAII by members of the steroid hormone receptor superfamily HNF-4, AR... J Biol Chem. 1992 Aug 5;267(22):15849-60. | ||||
REF 33 | Identification and characterization of a 315-base pair enhancer, located more than 55 kilobases 5' of the apolipoprotein B gene, that confers expression in the intestine. J Biol Chem. 2000 Aug 25;275(34):26637-48. | ||||
REF 34 | Mitogen-activated protein kinase regulates transcription of the ApoCIII gene. Involvement of the orphan nuclear receptor HNF4. J Biol Chem. 1999 Nov 12;274(46):33050-6. | ||||
REF 35 | cis-acting elements and transcription factors involved in the promoter activity of the human factor VIII gene. J Biol Chem. 1995 May 19;270(20):11828-38. | ||||
REF 36 | The orphan receptor hepatic nuclear factor 4 functions as a transcriptional activator for tissue-specific and hypoxia-specific erythropoietin gene expression and is antagonized by EAR3/COUP-TF1. Mol Cell Biol. 1995 Apr;15(4):2135-44. | ||||
REF 37 | Characterization of the human cytochrome P4502D6 promoter. A potential role for antagonistic interactions between members of the nuclear receptor family. J Biol Chem. 1996 Oct 11;271(41):25269-76. | ||||
REF 38 | Co-operation of the transcription factor hepatocyte nuclear factor-4 with Sp1 or Sp3 leads to transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line. Biochem J. 2002 Nov 1;367(Pt 3):641-52. | ||||
REF 39 | Disruption of a C/EBP binding site in the factor IX promoter is associated with haemophilia B. Nature. 1990 May 31;345(6274):444-6. | ||||
REF 40 | Regulated expression of human angiotensinogen gene by hepatocyte nuclear factor 4 and chicken ovalbumin upstream promoter-transcription factor. J Biol Chem. 1999 Dec 3;274(49):34605-12. | ||||
REF 41 | A different combination of transcription factors modulates the expression of the human transferrin promoter in liver and Sertoli cells. J Biol Chem. 1993 Nov 5;268(31):23399-408. | ||||
REF 42 | Binding specificity and modulation of the human ApoCIII promoter activity by heterodimers of ligand-dependent nuclear receptors. Biochemistry. 1999 Jan 19;38(3):964-75. | ||||
REF 43 | Acceleration of thrombomodulin gene transcription by retinoic acid: retinoic acid receptors and Sp1 regulate the promoter activity through interactions with two different sequences in the 5'-flanking region of human gene. J Biol Chem. 2001 Jan 26;276(4):2440-50. | ||||
REF 44 | Identification and characterization of a functional retinoic acid/thyroid hormone-response element upstream of the human insulin gene enhancer. Biochem J. 1995 Aug 1;309 ( Pt 3):863-70. | ||||
REF 45 | Heterodimeric retinoic acid receptor-beta and retinoid X receptor-alpha complexes stimulate expression of the intercellular adhesion molecule-1 gene. Cell Growth Differ. 1995 May;6(5):515-21. | ||||
REF 46 | Identification of a retinoic acid responsive element in the retinoic acid receptor beta gene. Nature. 1990 Jan 11;343(6254):177-80. | ||||
REF 47 | Transcriptional regulation of the apolipoprotein B100 gene: purification and characterization of trans-acting factor BRF-2. Mol Cell Biol. 1992 Jul;12(7):3183-91. | ||||
REF 48 | Antagonism between apolipoprotein AI regulatory protein 1, Ear3/COUP-TF, and hepatocyte nuclear factor 4 modulates apolipoprotein CIII gene expression in liver and intestinal cells. Mol Cell Biol. 1992 Apr;12(4):1708-18. | ||||
REF 49 | Hepatic nuclear factor 3 and high mobility group I/Y proteins bind the insulin response element of the insulin-like growth factor-binding protein-1 promoter. Endocrinology. 1997 Oct;138(10):4291-300. | ||||
REF 50 | Transcriptional regulation of the cholesteryl ester transfer protein gene by the orphan nuclear hormone receptor apolipoprotein AI regulatory protein-1. J Biol Chem. 1995 Dec 15;270(50):29916-22. | ||||
REF 51 | The mechanism by which the human apolipoprotein B gene reducer operates involves blocking of transcriptional activation by hepatocyte nuclear facto... Mol Cell Biol. 1993 Mar;13(3):1534-46. | ||||
REF 52 | Structure of the hepatic control region of the human apolipoprotein E/C-I gene locus. J Biol Chem. 1995 Sep 22;270(38):22577-85. | ||||
REF 53 | The Wilms' tumor gene product, WT1, represses transcription of the platelet-derived growth factor A-chain gene. J Biol Chem. 1992 Nov 5;267(31):21999-2002. | ||||
REF 54 | c-sis/PDGF-B promoter transactivation by the Yax protein of human T-cell leukemia virus type 1. J Biol Chem. 1996 Jun 14;271(24):14584-90. | ||||
REF 55 | In vivo footprinting and mutational analysis of the proximal CD19 promoter reveal important roles for an SP1/Egr-1 binding site and a novel site termed the PyG box. J Immunol. 1997 Aug 1;159(3):1284-92. | ||||
REF 56 | Early Growth Response-1 gene mediates up-regulation of epidermal growth factor receptor expression during hypoxia. Cancer Res. 2002 Feb 1;62(3):827-34. | ||||
REF 57 | The human copper-zinc superoxide dismutase gene (SOD1) proximal promoter is regulated by Sp1, Egr-1, and WT1 via non-canonical binding sites. J Biol Chem. 1999 Jan 1;274(1):503-9. | ||||
REF 58 | Early growth response-1-dependent apoptosis is mediated by p53. J Biol Chem. 1997 Aug 8;272(32):20131-8. | ||||
REF 59 | Granulocyte-macrophage colony-stimulating factor and interleukin-3 signaling pathways converge on the CREB-binding site in the human egr-1 promoter. Mol Cell Biol. 1994 Sep;14(9):5975-85. | ||||
REF 60 | Role of the liver-enriched transcription factor hepatocyte nuclear factor 1 in transcriptional regulation of the factor V111 gene. Mol Cell Biol. 1996 May;16(5):1936-45. | ||||
REF 61 | Cloning of the cDNA encoding human C/EBP gamma, a protein binding to the PRE-I enhancer element of the human interleukin-4 promoter. Gene. 1995 Aug 19;161(2):271-5. | ||||
REF 62 | Cell cycle regulation of cdc25C transcription is mediated by the periodic repression of the glutamine-rich activators NF-Y and Sp1. Nucleic Acids Res. 1995 Oct 11;23(19):3822-30. | ||||
REF 63 | Regulation of the catalase gene promoter by Sp1, CCAAT-recognizing factors, and a WT1/Egr-related factor in hydrogen peroxide-resistant HP100 cells. Cancer Res. 2001 Aug 1;61(15):5885-94. | ||||
REF 64 | Sp1-mediated transcriptional activation of the human Pi class glutathione S-transferase promoter. J Biol Chem. 1996 Jan 12;271(2):1054-60. | ||||
REF 65 | Binding and functional effects of transcription factors Sp1 and Sp3 on the proximal human lecithin:cholesterol acyltransferase promoter. J Lipid Res. 1998 May;39(5):969-77. | ||||
REF 66 | Characterization of a human apolipoprotein E gene enhancer element and its associated protein factors. J Biol Chem. 1990 Jun 5;265(16):9496-504. | ||||
REF 67 | Regulation of MCL1 through a serum response factor/Elk-1-mediated mechanism links expression of a viability-promoting member of the BCL2 family to the induction of hematopoietic cell differentiation. J Biol Chem. 1999 Jan 15;274(3):1801-13. | ||||
REF 68 | Sp1 is essential for both enhancer-mediated and basal activation of the TATA-less human adenosine deaminase promoter. Nucleic Acids Res. 1994 Feb 25;22(4):669-77. | ||||
REF 69 | Intracellular cholesterol transport in synchronized human skin fibroblasts. Biochemistry. 1999 Feb 23;38(8):2506-13. | ||||
REF 70 | Transforming growth factor-beta stimulates alpha 2(I) collagen gene expression through a cis-acting element that contains an Sp1-binding site. J Biol Chem. 1994 May 20;269(20):14828-34. | ||||
REF 71 | Regulation of transcription of the human erythropoietin receptor gene by proteins binding to GATA-1 and Sp1 motifs. Nucleic Acids Res. 1995 Aug 11;23(15):3041-9. | ||||
REF 72 | The nuclear factor YY1 suppresses the human gamma interferon promoter through two mechanisms: inhibition of AP1 binding and activation of a silence... Mol Cell Biol. 1996 Sep;16(9):4744-53. | ||||
REF 73 | Transcription factor repression and activation of the human acetylcholinesterase gene. J Biol Chem. 1995 Oct 6;270(40):23511-9. | ||||
REF 74 | The serotonin 1a receptor gene contains a TATA-less promoter that responds to MAZ and Sp1. J Biol Chem. 1996 Feb 23;271(8):4417-30. | ||||
REF 75 | Genomic organization and functional characterization of the chemokine receptor CXCR4, a major entry co-receptor for human immunodeficiency virus type 1. J Biol Chem. 1998 Feb 20;273(8):4754-60. | ||||
REF 76 | Novel role for Sp1 in phorbol ester enhancement of human platelet thromboxane receptor gene expression. J Biol Chem. 1996 Aug 16;271(33):19696-704. | ||||
REF 77 | Identification of a thrombin response element in the human platelet-derived growth factor B-chain (c-sis) promoter. J Biol Chem. 1996 Feb 9;271(6):3025-32. | ||||
REF 78 | Regulation of the transforming growth factor-beta 1 and -beta 3 promoters by transcription factor Sp1. Gene. 1993 Jul 30;129(2):223-8. | ||||
REF 79 | Stat1 depends on transcriptional synergy with Sp1. J Biol Chem. 1995 Dec 22;270(51):30264-7. | ||||
REF 80 | Binding of phosphorylated Sp1 protein to tandem Sp1 binding sites regulates alpha2 integrin gene core promoter activity. Blood. 1997 Jul 15;90(2):678-89. | ||||
REF 81 | Transcription factors ets1, NF-kappa B, and Sp1 are major determinants of the promoter activity of the human protein kinase CK2alpha gene. J Biol Chem. 2000 Jun 16;275(24):18327-36. | ||||
REF 82 | Identification of an estrogen-mediated deoxyribonucleic acid-binding independent transactivation pathway on the epidermal growth factor receptor gene promoter. Endocrinology. 2000 Jun;141(6):2266-74. | ||||
REF 83 | The human Pim-1 gene is selectively transcribed in different hemato-lymphoid cell lines in spite of a G + C-rich housekeeping promoter. Mol Cell Biol. 1990 Apr;10(4):1680-8. | ||||
REF 84 | Sp1 cooperates with c-Myc to activate transcription of the human telomerase reverse transcriptase gene (hTERT). Nucleic Acids Res. 2000 Feb 1;28(3):669-77. | ||||
REF 85 | Constitutive protection of E2F recognition sequences in the human thymidine kinase promoter during cell cycle progression. J Biol Chem. 1997 Nov 28;272(48):30483-90. | ||||
REF 86 | Co-stimulation of promoter for low density lipoprotein receptor gene by sterol regulatory element-binding protein and Sp1 is specifically disrupted by the yin yang 1 protein. J Biol Chem. 1999 May 7;274(19):13025-32. | ||||
REF 87 | Mast cell-/basophil-specific transcriptional regulation of human L-histidine decarboxylase gene by CpG methylation in the promoter region. J Biol Chem. 1998 Nov 20;273(47):31607-14. | ||||
REF 88 | Cell-specific transcription of leukotriene C(4) synthase involves a Kruppel-like transcription factor and Sp1. J Biol Chem. 2000 Mar 24;275(12):8903-10. | ||||
REF 89 | Sp1 binding sites and an estrogen response element half-site are involved in regulation of the human progesterone receptor A promoter. Mol Endocrinol. 2000 Jul;14(7):972-85. | ||||
REF 90 | Transcriptional activation of human 12-lipoxygenase gene promoter is mediated through Sp1 consensus sites in A431 cells. Biochem J. 1997 May 15;324 ( Pt 1):133-40. | ||||
REF 91 | Minimal sequence and factor requirements for the initiation of transcription from an atypical, TATATAA box-containing housekeeping promoter. J Biol Chem. 1990 Nov 25;265(33):20524-32. | ||||
REF 92 | Actions of two different cAMP-responsive sequences and an enhancer of the human CYP11A1 (P450scc) gene in adrenal Y1 and placental JEG-3 cells. J Biol Chem. 1994 Mar 4;269(9):6362-9. | ||||
REF 93 | Noradrenergic-specific transcription of the dopamine beta-hydroxylase gene requires synergy of multiple cis-acting elements including at least two Phox2a-binding sites. J Neurosci. 1998 Oct 15;18(20):8247-60. | ||||
REF 94 | The proximal promoter region of the gene encoding human 17beta-hydroxysteroid dehydrogenase type 1 contains GATA, AP-2, and Sp1 response elements: analysis of promoter function in choriocarcinoma cells. Endocrinology. 1997 Aug;138(8):3417-25. | ||||
REF 95 | Transcriptional regulation of endothelial nitric-oxide synthase by lysophosphatidylcholine. J Biol Chem. 1998 Jun 12;273(24):14885-90. | ||||
REF 96 | Sp1 and C/EBP-related factor regulate the transcription of human Cu/Zn SOD gene. Gene. 1996 Oct 31;178(1-2):177-85. | ||||
REF 97 | The human caspase-8 promoter sustains basal activity through SP1 and ETS-like transcription factors and can be up-regulated by a p53-dependent mechanism. J Biol Chem. 2003 Jul 25;278(30):27593-604. | ||||
REF 98 | Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells. J Biol Chem. 1994 Jun 3;269(22):15912-7. | ||||
REF 99 | Expression of the dibasic proprotein processing enzyme furin is directed by multiple promoters. J Biol Chem. 1994 Mar 25;269(12):9298-303. | ||||
REF 100 | Cloning and functional characterization of the 5' flanking region of the human mitochondrial malic enzyme gene. Regulatory role of Sp1 and AP-2. Eur J Biochem. 2001 May;268(10):3017-27. | ||||
REF 101 | Transcriptional regulation of the human neuropeptide Y gene by nerve growth factor. J Biol Chem. 1994 Jun 3;269(22):15460-8. | ||||
REF 102 | Effect of abasic linker substitution on triplex formation, Sp1 binding, and specificity in an oligonucleotide targeted to the human Ha-ras promoter. Nucleic Acids Res. 1994 May 25;22(10):1909-16. | ||||
REF 103 | Sp1 and thyroid hormone receptor differentially activate expression of human growth hormone and chorionic somatomammotropin genes. J Biol Chem. 1991 May 25;266(15):9805-13. | ||||
REF 104 | Cloning and characterization of the 5'-flanking region of the human transcription factor Sp1 gene. J Biol Chem. 2001 Jun 22;276(25):22126-32. | ||||
REF 105 | Characterization of the transcriptional regulatory region of the human WT1 gene. Oncogene. 1993 Nov;8(11):3123-32. | ||||
REF 106 | YY1 and Sp1 transcription factors bind the human transferrin gene in an age-related manner. J Gerontol A Biol Sci Med Sci. 1996 Jan;51(1):B66-75. | ||||
REF 107 | Sp1 and Sp3 physically interact and co-operate with GABP for the activation of the utrophin promoter. J Mol Biol. 2001 Mar 9;306(5):985-96. | ||||
REF 108 | Transcriptional regulation of the human lipoprotein lipase gene in 3T3-L1 adipocytes. J Biol Chem. 1991 Oct 5;266(28):18958-63. | ||||
REF 109 | The liver-specific promoter of the human insulin-like growth factor II gene is activated by CCAAT/enhancer binding protein (C/EBP). Nucleic Acids Res. 1992 Jun 25;20(12):3099-104. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.