Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T28226
|
||||
| Former ID |
TTDR00115
|
||||
| Target Name |
GTP cyclohydrolase I
|
||||
| Gene Name |
GCH1
|
||||
| Synonyms |
GTP-CH-I; Guanosine triphosphate cyclohydrolase I; GCH1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Parkinson's disease [ICD9: 332; ICD10: G20] | ||||
| Function |
Isoform gch-1 is the functional enzyme, the potential function of the enzymatically inactive isoforms remains unknown.
|
||||
| BioChemical Class |
Carbon-nitrogen hydrolase
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.5.4.16
|
||||
| Sequence |
MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRS
EEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDA IFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQ VQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKT REEFLTLIRS |
||||
| Structure |
1FB1
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Guanine | Drug Info | Phase 3 | Discovery agent | [1], [2] |
| ProSavin | Drug Info | Phase 1/2 | Parkinson's disease | [3] | |
| Inhibitor | 8-hydroxyguanine | Drug Info | [4] | ||
| Guanine | Drug Info | [4] | |||
| Guanosine-5'-Triphosphate | Drug Info | [5] | |||
| Isopropyl Alcohol | Drug Info | [6] | |||
| Modulator | ProSavin | Drug Info | [7] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| PathWhiz Pathway | Pterine Biosynthesis | ||||
| Reactome | Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation | ||||
| References | |||||
| REF 1 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4556). | ||||
| REF 2 | ClinicalTrials.gov (NCT00001100) A Phase III Study to Evaluate the Safety and Efficacy of Ganciclovir (Dihydroxypropoxymethyl Guanine [DHPG]) Treatment of Symptomatic Central Nervous System (CNS) Congenital Cytomegalovirus (CMV) Infections.. U.S. National Institutes of Health. | ||||
| REF 3 | ClinicalTrials.gov (NCT01856439) Long Term Safety and Efficacy Study of ProSavin in Parkinson's Disease. U.S. National Institutes of Health. | ||||
| REF 4 | GTP cyclohydrolase I feedback regulatory protein-dependent and -independent inhibitors of GTP cyclohydrolase I. Arch Biochem Biophys. 2001 Apr 1;388(1):67-73. | ||||
| REF 5 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 6 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
| REF 7 | Clinical pipeline report, company report or official report of Oxford BioMedica. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.