Target Information

Target General Infomation
Target ID
T02703
Former ID
TTDS00337
Target Name
Nitric oxide synthase, inducible
Gene Name
NOS2
Synonyms
HEP-NOS; Hepatocyte NOS; INOS; Inducible NOS; Inducible nitric oxide synthase; NOS, type II; NOS2
Target Type
Clinical Trial
Disease Asthma [ICD10: J45]
Coronary artery disease [ICD9: 410-414, 429.2; ICD10: I20-I25]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Diabetic kidney disease [ICD10: E11.22]
Endotoxic shock [ICD10: R57.8]
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25]
Osteoarthritis [ICD9: 715; ICD10: M15-M19, M47]
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89]
Restenosis [ICD10: I51.89]
Septic shock [ICD9: 785.52; ICD10: A41.9]
Function
Produces nitric oxide (no) which is a messenger molecule with diverse functions throughout the body. In macrophages, no mediates tumoricidal and bactericidal actions.
BioChemical Class
Oxidoreductases acting on paired donors
Target Validation
T02703
UniProt ID
P35228
EC Number
EC 1.14.13.39
Sequence
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY
VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR
VAVQPSSLEMSAL
Drugs and Mode of Action
Drug(s) Curcumin Drug Info Phase 3 Cancer [532348], [542031]
MPL-S Drug Info Phase 3 Endotoxic shock [522351]
SD-6010 Drug Info Phase 3 Osteoarthritis [523634]
Pimagedine HCl Drug Info Phase 2/3 Diabetic kidney disease [546189]
GW274150 Drug Info Phase 2 Asthma [521884]
KD-7040 Drug Info Phase 2 Pain [522187]
LT-1951 Drug Info Phase 1/2 Coronary artery disease [521773]
Aminoguanidine Drug Info Phase 1 Discovery agent [468198], [521693]
NOStentin Drug Info Discontinued in Phase 1 Restenosis [547127]
ONO-1714 Drug Info Discontinued in Phase 1 Septic shock [547187]
L-NIL Drug Info Terminated Discovery agent [546719]
Inhibitor ((E)-7-But-2-enyl)-azepan-(2Z)-ylideneamine Drug Info [526140]
(4S,5R)-4,5-Diethyl-oxazolidin-(2Z)-ylideneamine Drug Info [526912]
(4S,5R)-4,5-Dimethyl-oxazolidin-(2Z)-ylideneamine Drug Info [526912]
(4S,5R)-4,5-Dipropyl-oxazolidin-(2Z)-ylideneamine Drug Info [526912]
(4S,5S)-4,5-Diethyl-oxazolidin-(2Z)-ylideneamine Drug Info [526912]
(4S,5S)-4,5-Dipropyl-oxazolidin-(2Z)-ylideneamine Drug Info [526912]
(5-Imino-[1,4]thiazepan-3-yl)-methanol Drug Info [527266]
(5S,6R)-[Octahydro-quinolin-(2E)-ylidene]amine Drug Info [527502]
(5S,6S)-[Octahydro-quinolin-(2E)-ylidene]amine Drug Info [527502]
(6r,1'r,2's)-5,6,7,8 Tetrahydrobiopterin Drug Info [551393]
(E)-4-Methyl-6-(prop-1-enyl)pyridin-2-amine Drug Info [530039]
(R)-3-Propyl-[1,4]thiazepan-(5E)-ylideneamine Drug Info [527266]
(S)-2-Amino-5-(N-methyl-guanidino)-pentanoic acid Drug Info [534097]
(S)-2-Amino-6-[(E)-ethylimino]-hexanoic acid Drug Info [534097]
(S)-3-Propyl-[1,4]thiazepan-(5E)-ylideneamine Drug Info [527266]
(S)-6-Amino-2-(2-imino-ethylamino)-hexanoic acid Drug Info [527266]
(S)-N-(1-phenylethyl)acetimidamide hydrobromide Drug Info [531201]
1-(6-Amino-4-methylpyridin-2-yl)propan-2-ol Drug Info [530039]
1400W Drug Info [534325]
2-(2-Amino-ethyl)-7-imino-azepane Drug Info [526140]
2-amino-4-methylpyridine Drug Info [534283]
2-Amino-5-(N-nitro-guanidino)-pentanoic acid Drug Info [534097]
2-Methyl-[1,4]thiazepan-(5E)-ylideneamine Drug Info [527266]
3,4-Dihydro-1H-quinolin-(2E)-ylideneamine Drug Info [527502]
3,4-Dimethyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
3-(2-Amino-ethyl)-5-imino-[1,4]oxazepane Drug Info [526140]
3-(2-Nitro-ethyl)-[1,4]oxazepan-(5Z)-ylideneamine Drug Info [526140]
3-Bromo-1H-indazole-7-carbonitrile Drug Info [529494]
3-bromo-7-nitro-1H-indazole Drug Info [530315]
3-Bromo-7-Nitroindazole Drug Info [551393]
3-Butyl-[1,4]oxazepan-(5Z)-ylideneamine Drug Info [526140]
3-Butyl-[1,4]thiazepan-(5E)-ylideneamine Drug Info [527266]
3-Ethyl-[1,4]thiazepan-(5E)-ylideneamine Drug Info [527266]
3-Isobutyl-[1,4]thiazepan-(5E)-ylideneamine Drug Info [527266]
3-Methyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
3-Methyl-[1,4]thiazepan-(5E)-ylideneamine Drug Info [527266]
3-Propyl-[1,4]thiazepan-(5E)-ylideneamine Drug Info [527266]
4,5,6,7-tetrafluoro-3-methyl-1H-indazole Drug Info [530315]
4,5,6,7-tetrafluoro-3-perfluorophenyl-1H-indazole Drug Info [530315]
4,5-Dimethyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
4-(1H-IMIDAZOL-1-YL)PHENOL Drug Info [551374]
4-Butyl-thiazolidin-(2E)-ylideneamine Drug Info [527210]
4-Ethyl-3-methyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
4-Ethyl-5-methyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
4-Ethyl-oxazolidin-(2Z)-ylideneamine Drug Info [526912]
4-Ethyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
4-Isopropyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
4-Methyl-5-propyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
4-Methyl-6-(2-methylprop-1-enyl)pyridin-2-amine Drug Info [530039]
4-methyl-6-propylpyridin-2-amine Drug Info [529745]
4-Methyl-oxazolidin-(2Z)-ylideneamine Drug Info [526912]
4-Methyl-piperidin-(2E)-ylideneamine Drug Info [527502]
4-Methyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
4-methylpyridin-2-amine Drug Info [529745]
4-[(2-Methyl-1H-imidazol-1-yl)methyl]pyridine Drug Info [531201]
4r-Fluoro-N6-Ethanimidoyl-L-Lysine Drug Info [551393]
5-Bromomethyl-oxazolidin-(2Z)-ylideneamine Drug Info [526912]
5-Ethyl-4-methyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
5-Ethyl-4-propyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
5-Ethyl-oxazolidin-(2Z)-ylideneamine Drug Info [526912]
5-Methyl-4-propyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
5-Methyl-oxazolidin-(2Z)-ylideneamine Drug Info [526912]
5-Methyl-pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
5-Nitroindazole Drug Info [551393]
6-(2-Fluoropropyl)-4-methylpyridin-2-amine Drug Info [530039]
6-(3-Fluoropropyl)-4-methylpyridin-2-amine Drug Info [530039]
6-(4-Fluorobutyl)-4-methylpyridin-2-amine Drug Info [530039]
6-isobutyl-4-methylpyridin-2-amine Drug Info [530039]
6-methyl-5,6-dihydro-4H-1,3-thiazin-2-amine Drug Info [529827]
6-Nitroindazole Drug Info [551393]
7,8-Dihydro-L-Biopterin Drug Info [551391]
7,8-dihydrobiopterin Drug Info [551393]
7-(2-Nitro-ethyl)-azepan-(2Z)-ylideneamine Drug Info [526140]
7-Butyl-azepan-(2Z)-ylideneamine Drug Info [526140]
7-Methyl-[1,4]thiazepan-(5E)-ylideneamine Drug Info [527266]
7-nitro-1H-indazole Drug Info [530315]
7-Nitroindazole Drug Info [551393]
Aminoguanidine Drug Info [537573]
AMINOTHIAZOLINE Drug Info [529755]
AR-C102222 Drug Info [529745]
AR-C133057XX Drug Info [529745]
Azepan-(2Z)-ylideneamine Drug Info [526140]
Azocan-(2Z)-ylideneamine Drug Info [526140]
Azonan-(2Z)-ylideneamine Drug Info [534097]
B-Octylglucoside Drug Info [551393]
BYK-191023 Drug Info [543390]
CDDO Drug Info [527517]
Curcumin Drug Info [529213]
Ethylisothiourea Drug Info [551393]
Heme Drug Info [551374]
Hexahydro-cyclopenta[c]pyrrol-(1Z)-ylideneamine Drug Info [527210]
KD-7040 Drug Info [550174]
KD-7332 Drug Info [543390]
L-NIL Drug Info [529159]
L-NIO Drug Info [529811]
L-Nw-nitroarginine Drug Info [531224]
L-Thiocitrulline Drug Info [551393]
N,N-dimethylarginine Drug Info [551405]
N-(3-(aminomethyl)-benzyl)acetamidine Drug Info [531201]
N-(3-(Aminomethyl)Benzyl)Acetamidine Drug Info [551374]
N-(5-Amino-6-oxo-heptyl)-acetamidine Drug Info [527210]
N-benzylacetimidamide hydrobromide Drug Info [531201]
N-omega-allyl-L-arginine Drug Info [529811]
N-Omega-Hydroxy-L-Arginine Drug Info [551393]
N-omega-propargyl-L-arginine Drug Info [529811]
N-Omega-Propyl-L-Arginine Drug Info [551393]
N5-(1-iminobut-3-enyl)-L-ornithine Drug Info [529811]
N5-(1-iminobutyl)-L-ornithine Drug Info [529811]
N5-(1-iminopropyl)-L-ornithine Drug Info [529811]
Octahydro-isoindol-(1Z)-ylideneamine Drug Info [527210]
Oxazolidin-(2Z)-ylideneamine Drug Info [526912]
PIBTU Drug Info [533614]
Pimagedine HCl Drug Info [529604]
Piperidin-(2E)-ylideneamine Drug Info [527502]
Pyrrolidin-(2Z)-ylideneamine Drug Info [527210]
Resveratrol Potassium4,-Sulfate Drug Info [530955]
S-Ethylisothiourea Drug Info [551393]
SD-6010 Drug Info [532114]
Thiazolidin-(2E)-ylideneamine Drug Info [527210]
THIOCITRULLINE Drug Info [527563]
Thiocoumarin Drug Info [551374]
[1,3]Oxazinan-(2E)-ylideneamine Drug Info [534097]
[1,3]Thiazinan-(2E)-ylideneamine Drug Info [534097]
[1,4]Oxazepan-(3E)-ylideneamine Drug Info [527266]
[1,4]Oxazepan-(5E)-ylideneamine Drug Info [527266]
[1,4]Thiazepan-(3E)-ylideneamine Drug Info [527266]
[1,4]Thiazepan-(5E)-ylideneamine Drug Info [527266]
[1,5]Thiazocan-(4E)-ylideneamine Drug Info [526140]
Modulator GW274150 Drug Info [527488]
LT-1951 Drug Info [526624]
MPL-S Drug Info [534435]
NOStentin Drug Info [527754]
ONO-1714 Drug Info
SKLB-010 Drug Info [543390]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
BioCyc Pathway Citrulline-nitric oxide cycle
KEGG Pathway Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Calcium signaling pathway
HIF-1 signaling pathway
Peroxisome
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Amoebiasis
Tuberculosis
Pathways in cancer
Small cell lung cancer
NetPath Pathway IL1 Signaling Pathway
IL2 Signaling Pathway
Pathway Interaction Database IL12-mediated signaling events
Alpha9 beta1 integrin signaling events
ATF-2 transcription factor network
IL23-mediated signaling events
Signaling mediated by p38-alpha and p38-beta
HIF-1-alpha transcription factor network
Reactome ROS production in response to bacteria
Nitric oxide stimulates guanylate cyclase
WikiPathways Type II interferon signaling (IFNG)
Spinal Cord Injury
AGE/RAGE pathway
Effects of Nitric Oxide
References
Ref 468198(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5135).
Ref 521693ClinicalTrials.gov (NCT00184990) Effect of Selective iNOS Inhibition During Human Endotoxemia. U.S. National Institutes of Health.
Ref 521773ClinicalTrials.gov (NCT00264706) PolyArginine Treated vEiN grafTs (PATENT). U.S. National Institutes of Health.
Ref 521884ClinicalTrials.gov (NCT00370435) Study Of 90mg Of GW274150 In Subjects Over 50 Years, Who Have Rheumatoid Arthritis (RA). U.S. National Institutes of Health.
Ref 522187ClinicalTrials.gov (NCT00576108) A 2 Week Study of Topical KD7040 in the Treatment of Postherpetic Neuralgia (PHN). U.S. National Institutes of Health.
Ref 522351ClinicalTrials.gov (NCT00699764) Safety of a Herpes Simplex Candidate Vaccine (gD2t) With MPL and Its Efficacy to Prevent Genital Herpes Disease. U.S. National Institutes of Health.
Ref 523634ClinicalTrials.gov (NCT01438918) X-Ray Study Investigating The Safety And Efficacy Of SD-6010 In Subjects With Osteoarthritis Of The Knee. U.S. National Institutes of Health.
Ref 532348Nanocurcumin: a promising therapeutic advancement over native curcumin. Crit Rev Ther Drug Carrier Syst. 2013;30(4):331-68.
Ref 542031(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7000).
Ref 546189Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006816)
Ref 546719Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009876)
Ref 547127Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013241)
Ref 547187Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013758)
Ref 526140Bioorg Med Chem Lett. 2001 Oct 8;11(19):2651-3.Selective heterocyclic amidine inhibitors of human inducible nitric oxide synthase.
Ref 526624Critical role of L-arginine in endothelial cell survival during oxidative stress. Circulation. 2003 May 27;107(20):2607-14. Epub 2003 May 12.
Ref 526912Bioorg Med Chem Lett. 2004 Jan 19;14(2):313-6.4,5-Disubstituted-1,3-oxazolidin-2-imine derivatives: a new class of orally bioavailable nitric oxide synthase inhibitor.
Ref 527210Bioorg Med Chem Lett. 2004 Sep 6;14(17):4539-44.Evaluation of pyrrolidin-2-imines and 1,3-thiazolidin-2-imines as inhibitors of nitric oxide synthase.
Ref 527266Bioorg Med Chem Lett. 2004 Dec 6;14(23):5907-11.Synthesis of analogs of (1,4)-3- and 5-imino oxazepane, thiazepane, and diazepane as inhibitors of nitric oxide synthases.
Ref 527488Br J Pharmacol. 2005 Jun;145(3):301-12.GW274150 and GW273629 are potent and highly selective inhibitors of inducible nitric oxide synthase in vitro and in vivo.
Ref 527502Bioorg Med Chem Lett. 2005 Apr 15;15(8):1997-2001.Bicyclic amidine inhibitors of nitric oxide synthase: discovery of perhydro-iminopyrindine and perhydro-iminoquinoline as potent, orally active inhibitors of inducible nitric oxide synthase.
Ref 527517Bioorg Med Chem Lett. 2005 May 2;15(9):2215-9.Studies on the reactivity of CDDO, a promising new chemopreventive and chemotherapeutic agent: implications for a molecular mechanism of action.
Ref 527563Bioorg Med Chem Lett. 2005 Jun 2;15(11):2881-5. Epub 2005 Apr 25.Evaluation of 3-substituted arginine analogs as selective inhibitors of human nitric oxide synthase isozymes.
Ref 527754Gene therapy with iNOS provides long-term protection against myocardial infarction without adverse functional consequences. Am J Physiol Heart Circ Physiol. 2006 Feb;290(2):H584-9. Epub 2005 Sep 19.
Ref 529159Bioorg Med Chem Lett. 2008 Jan 1;18(1):336-43. Epub 2007 Oct 25.Discovery of a series of aminopiperidines as novel iNOS inhibitors.
Ref 529213Proc Natl Acad Sci U S A. 2007 Dec 18;104(51):20523-8. Epub 2007 Dec 11.A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases.
Ref 529494Bioorg Med Chem. 2008 Jun 1;16(11):5962-73. Epub 2008 Apr 26.Inhibitory effects of a series of 7-substituted-indazoles toward nitric oxide synthases: particular potency of 1H-indazole-7-carbonitrile.
Ref 529604Nitric oxide associated with iNOS expression inhibits acetylcholinesterase activity and induces memory impairment during acute hypobaric hypoxia. Brain Res. 2008 Sep 16;1230:138-49.
Ref 529745Nat Chem Biol. 2008 Nov;4(11):700-7. Epub 2008 Oct 12.Anchored plasticity opens doors for selective inhibitor design in nitric oxide synthase.
Ref 529755Bioorg Med Chem Lett. 2008 Dec 1;18(23):6206-9. Epub 2008 Oct 5.The design, synthesis and biological evaluation of 7-alkoxy-4-heteroarylamino-3-cyanoquinolines as dual inhibitors of c-Src and iNOS.
Ref 529811Bioorg Med Chem. 2008 Dec 15;16(24):10205-9. Epub 2008 Oct 29.Structure-activity relationship of novel and known inhibitors of human dimethylarginine dimethylaminohydrolase-1: alkenyl-amidines as new leads.
Ref 529827Bioorg Med Chem Lett. 2009 Jan 1;19(1):74-6. Epub 2008 Nov 12.Synthesis of biflavones having a 6-O-7'' linkage and effects on cyclooxygenase-2 and inducible nitric oxide synthase.
Ref 530039J Med Chem. 2009 Apr 23;52(8):2443-53.Design and synthesis of 2-amino-4-methylpyridine analogues as inhibitors for inducible nitric oxide synthase and in vivo evaluation of [18F]6-(2-fluoropropyl)-4-methyl-pyridin-2-amine as a potential PET tracer for inducible nitric oxide synthase.
Ref 530315Bioorg Med Chem. 2009 Sep 1;17(17):6180-7. Epub 2009 Aug 6.Fluorinated indazoles as novel selective inhibitors of nitric oxide synthase (NOS): synthesis and biological evaluation.
Ref 530955J Med Chem. 2010 Jul 8;53(13):5033-43.Selective synthesis and biological evaluation of sulfate-conjugated resveratrol metabolites.
Ref 531201Bioorg Med Chem Lett. 2010 Nov 15;20(22):6495-9. Epub 2010 Sep 17.N-Substituted acetamidines and 2-methylimidazole derivatives as selective inhibitors of neuronal nitric oxide synthase.
Ref 531224J Med Chem. 2010 Nov 11;53(21):7804-24.Exploration of the active site of neuronal nitric oxide synthase by the design and synthesis of pyrrolidinomethyl 2-aminopyridine derivatives.
Ref 532114A 2-year randomised, double-blind, placebo-controlled, multicentre study of oral selective iNOS inhibitor, cindunistat (SD-6010), in patients with symptomatic osteoarthritis of the knee. Ann Rheum Dis. 2013 Feb;72(2):187-95.
Ref 533614Potent and selective inhibition of human nitric oxide synthases. Inhibition by non-amino acid isothioureas. J Biol Chem. 1994 Oct 28;269(43):26669-76.
Ref 534097J Med Chem. 1996 Feb 2;39(3):669-72.2-Iminopiperidine and other 2-iminoazaheterocycles as potent inhibitors of human nitric oxide synthase isoforms.
Ref 534283Br J Pharmacol. 1996 Nov;119(6):1101-8.2-Amino-4-methylpyridine as a potent inhibitor of inducible NO synthase activity in vitro and in vivo.
Ref 5343251400W is a slow, tight binding, and highly selective inhibitor of inducible nitric-oxide synthase in vitro and in vivo. J Biol Chem. 1997 Feb 21;272(8):4959-63.
Ref 534435Lipopolysaccharide and monophosphoryl lipid A differentially regulate interleukin-12, gamma interferon, and interleukin-10 mRNA production in murine macrophages. Infect Immun. 1997 Aug;65(8):3239-47.
Ref 537573Inhibitory effects of aminoguanidine on thyroid follicular carcinoma development in inflamed capsular regions of rats treated with sulfadimethoxine after N-bis(2-hydroxypropyl)nitrosamine-initiation.Cancer Sci. 2009 Jul 1.
Ref 543390(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1250).
Ref 550174WO patent application no. 2014,0214,08, Method for treating cancer by anticancer agent co-administration.
Ref 551374The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
Ref 551391DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
Ref 551405van Guldener C, Nanayakkara PW, Stehouwer CD: Review: Homocysteine and asymmetric dimethylarginine (<span class="caps">ADMA</span>): biochemically linked but differently related to vascular disease in chronic kidney disease. Clin Chem Lab Med. 2007 Oct 15;.
Ref 1587926URL: https://www.ebi.ac.uk/chembl/ The ChEMBL database in 2017

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.