Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T84486
(Former ID: TTDS00264)
|
|||||
Target Name |
Oxytocin receptor (OTR)
|
|||||
Synonyms |
OT-R
|
|||||
Gene Name |
OXTR
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 3 Target-related Diseases | + | ||||
1 | Acute diabete complication [ICD-11: 5A2Y] | |||||
2 | Autism spectrum disorder [ICD-11: 6A02] | |||||
3 | Postpartum haemorrhage [ICD-11: JA43] | |||||
Function |
The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Receptor for oxytocin.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACV
LLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA AEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGET SASKKSNSSSFVLSHRSSSQRSCSQPSTA Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A01759 ; BADD_A05900 | |||||
HIT2.0 ID | T76GZS |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 3 Approved Drugs | + | ||||
1 | Carbetocin | Drug Info | Approved | Postpartum haemorrhage | [2] | |
2 | Desmopressin | Drug Info | Approved | Diabetic complication | [3], [4], [5] | |
3 | Oxytocin | Drug Info | Approved | Autism spectrum disorder | [6] | |
Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
1 | Retosiban | Drug Info | Phase 3 | Preterm labour | [7], [8] | |
2 | Barusiban | Drug Info | Phase 2 | Androgen deficiency | [9] | |
3 | FE-202767 | Drug Info | Phase 2 | Erectile dysfunction | [10] | |
4 | GSK-557296 | Drug Info | Phase 2 | Premature ejaculation | [11] | |
5 | SSR149415 | Drug Info | Phase 2 | Anxiety disorder | [12], [13], [14] | |
Discontinued Drug(s) | [+] 4 Discontinued Drugs | + | ||||
1 | L-368899 | Drug Info | Discontinued in Phase 1 | Miscarriage | [15], [16] | |
2 | PF-3274167 | Drug Info | Discontinued in Phase 1 | Female sexual arousal dysfunction | [17] | |
3 | TT-235 | Drug Info | Discontinued in Phase 1 | Miscarriage | [18] | |
4 | AS-602305 | Drug Info | Terminated | Androgen deficiency | [19] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Agonist | [+] 5 Agonist drugs | + | ||||
1 | Carbetocin | Drug Info | [1], [20], [21] | |||
2 | Desmopressin | Drug Info | [22] | |||
3 | FE-202767 | Drug Info | [23] | |||
4 | [Phe3]OT | Drug Info | [45] | |||
5 | [Thr4,Gly7]OT | Drug Info | [46] | |||
Modulator | [+] 2 Modulator drugs | + | ||||
1 | Oxytocin | Drug Info | [23], [24] | |||
2 | Retosiban | Drug Info | [26] | |||
Inhibitor | [+] 56 Inhibitor drugs | + | ||||
1 | ATOSIBAN | Drug Info | [25] | |||
2 | SSR149415 | Drug Info | [29] | |||
3 | PF-3274167 | Drug Info | [32] | |||
4 | L-371257 | Drug Info | [32] | |||
5 | 1'-tosylspiro[indene-1,4'-piperidine] | Drug Info | [32] | |||
6 | ARGENINE VASOPRESSIN | Drug Info | [35] | |||
7 | D(CH2)5[Tyr(Me)2,Thr4,Orn8(5/6C-Flu),Tyr-NH29]VT | Drug Info | [36] | |||
8 | D(CH2)5[Tyr(Me)2,Thr4,Orn8,Tyr9-NH2]VT | Drug Info | [36] | |||
9 | DesGly-NH2,d(CH2)5[D-Tyr2,Thr4,Orn8(5/6C-Flu)]VT | Drug Info | [36] | |||
10 | D[Arg4,Dab8]VP | Drug Info | [35] | |||
11 | D[Arg4,Lys8]VP | Drug Info | [35] | |||
12 | D[Arg4,Orn8]VP | Drug Info | [35] | |||
13 | D[Arg4]AVP | Drug Info | [35] | |||
14 | D[Cha4,Dab8]VP | Drug Info | [35] | |||
15 | D[Cha4,Dap8]VP | Drug Info | [35] | |||
16 | D[Cha4,Lys8]VP | Drug Info | [35] | |||
17 | D[Cha4,Orn8]VP | Drug Info | [35] | |||
18 | D[Cha4]AVP | Drug Info | [35] | |||
19 | D[Leu4,Dab8]VP | Drug Info | [35] | |||
20 | D[Leu4,Dap8]VP | Drug Info | [35] | |||
21 | D[Leu4,Lys8]VP | Drug Info | [35] | |||
22 | D[Leu4,Orn8]VP | Drug Info | [35] | |||
23 | D[Leu4]AVP | Drug Info | [35] | |||
24 | D[Lys8(5/6-Flu)]VT | Drug Info | [36] | |||
25 | D[Orn4,Lys8]VP | Drug Info | [35] | |||
26 | D[Orn4,Orn8]VP | Drug Info | [35] | |||
27 | D[Orn4]AVP | Drug Info | [35] | |||
28 | D[Orn8(5/6C-Flu)]VT | Drug Info | [36] | |||
29 | D[Thr4,Lys8(5/6C-Flu)]VT | Drug Info | [36] | |||
30 | D[Thr4,Orn8(5/6C-Flu)]VT | Drug Info | [36] | |||
31 | D[Val4]AVP | Drug Info | [35] | |||
32 | L-372662 | Drug Info | [32] | |||
33 | [Aib7]OT | Drug Info | [43] | |||
34 | [D-Tic7]OT | Drug Info | [43] | |||
35 | [Gly(But)7]OT | Drug Info | [43] | |||
36 | [HO1][Lys8(5/6C-Flu)]VT | Drug Info | [36] | |||
37 | [HO1][Orn8(5/6C-Flu)]VT | Drug Info | [36] | |||
38 | [HO1][Orn8(5/6C-Rhm)]VT | Drug Info | [36] | |||
39 | [HO1][Thr4,Lys8(5/6C-Flu)]VT | Drug Info | [36] | |||
40 | [HO1][Thr4,Orn8(5/6C-Flu)]VT | Drug Info | [36] | |||
41 | [L-Tic7]OT | Drug Info | [43] | |||
42 | [Lys8(Alexa 488) ]PVA | Drug Info | [44] | |||
43 | [Lys8(Alexa 546) ]PVA | Drug Info | [44] | |||
44 | [Mpa1, D-Tic2, Aib7]OT | Drug Info | [43] | |||
45 | [Mpa1, D-Tic7]OT | Drug Info | [43] | |||
46 | [Mpa1, D-Tyr(Et)2, Aib7, D-Tic9]OT | Drug Info | [43] | |||
47 | [Mpa1, D-Tyr(Et)2, Aib7]OT | Drug Info | [43] | |||
48 | [Mpa1, D-Tyr(Et)2, D-Tic7, Aib9]OT | Drug Info | [43] | |||
49 | [Mpa1, D-Tyr(Et)2, D-Tic7, D-Tic9]OT | Drug Info | [43] | |||
50 | [Mpa1, D-Tyr(Et)2, D-Tic7]OT | Drug Info | [43] | |||
51 | [Mpa1, D-Tyr(Et)2, Gly(But)3, Gly(But)7]OT | Drug Info | [43] | |||
52 | [Mpa1, D-Tyr(Et)2, Gly(But)7]OT | Drug Info | [43] | |||
53 | [Mpa1, D-Tyr(Et)2, L-Tic7]OT | Drug Info | [43] | |||
54 | [Mpa1, D-Tyr(Et)2, Pip7]OT | Drug Info | [43] | |||
55 | [Mpa1, L-Tic7]OT | Drug Info | [43] | |||
56 | [Pip7]OT | Drug Info | [43] | |||
Antagonist | [+] 27 Antagonist drugs | + | ||||
1 | Barusiban | Drug Info | [27] | |||
2 | GSK-557296 | Drug Info | [28] | |||
3 | PMID28906174-Compound-figure1g | Drug Info | [30] | |||
4 | Pyrrolidine derivative 10 | Drug Info | [30] | |||
5 | Pyrrolidine derivative 11 | Drug Info | [30] | |||
6 | Pyrrolidine derivative 12 | Drug Info | [30] | |||
7 | Pyrrolidine derivative 13 | Drug Info | [30] | |||
8 | Pyrrolidine derivative 9 | Drug Info | [30] | |||
9 | Triazole derivative 4 | Drug Info | [30] | |||
10 | Triazole derivative 5 | Drug Info | [30] | |||
11 | Triazole derivative 6 | Drug Info | [30] | |||
12 | Triazole derivative 7 | Drug Info | [30] | |||
13 | L-368899 | Drug Info | [31] | |||
14 | TT-235 | Drug Info | [33], [4] | |||
15 | AS-602305 | Drug Info | [34] | |||
16 | d(CH2)5[Tyr(Me)2]AVP | Drug Info | [37] | |||
17 | L-365,209 | Drug Info | [37] | |||
18 | L-366,509 | Drug Info | [37] | |||
19 | L-366,682 | Drug Info | [37] | |||
20 | L-366,948 | Drug Info | [37] | |||
21 | L-367,773 | Drug Info | [37] | |||
22 | L023103 | Drug Info | [38] | |||
23 | LS-192629 | Drug Info | [39] | |||
24 | PF-271836 | Drug Info | [23] | |||
25 | PMID16250654C37 | Drug Info | [40] | |||
26 | SSR126768A | Drug Info | [41] | |||
27 | [35S]-non-peptide OT antagonist | Drug Info | [42] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 4 KEGG Pathways | + | ||||
1 | Calcium signaling pathway | |||||
2 | cAMP signaling pathway | |||||
3 | Neuroactive ligand-receptor interaction | |||||
4 | Oxytocin signaling pathway | |||||
NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
1 | TGF_beta_Receptor Signaling Pathway | |||||
Panther Pathway | [+] 1 Panther Pathways | + | ||||
1 | Oxytocin receptor mediated signaling pathway | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Vasopressin-like receptors | |||||
2 | G alpha (q) signalling events | |||||
WikiPathways | [+] 7 WikiPathways | + | ||||
1 | GPCRs, Class A Rhodopsin-like | |||||
2 | Myometrial Relaxation and Contraction Pathways | |||||
3 | Oxytocin signaling | |||||
4 | Gastrin-CREB signalling pathway via PKC and MAPK | |||||
5 | Peptide GPCRs | |||||
6 | GPCR ligand binding | |||||
7 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Peptide and non-peptide agonists and antagonists for the vasopressin and oxytocin V1a, V1b, V2 and OT receptors: research tools and potential therapeutic agents. Prog Brain Res. 2008;170:473-512. | |||||
REF 2 | Clinical Textbook of Dental Hygiene and Therapy. 2006, P237. By Robert Ireland. | |||||
REF 3 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2182). | |||||
REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 5 | ClinicalTrials.gov (NCT00748072) 1-deamino 8-d-arginine Vasopressin (DDAVP) in Percutaneous Ultrasound-guided Renal Biopsy. U.S. National Institutes of Health. | |||||
REF 6 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2174). | |||||
REF 7 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8403). | |||||
REF 8 | ClinicalTrials.gov (NCT02377466) A Phase III Efficacy and Safety Study of Intravenous Retosiban Versus Placebo for Women in Spontaneous Preterm Labor. U.S. National Institutes of Health. | |||||
REF 9 | ClinicalTrials.gov (NCT00209326) A Proof of Concept Study Assessing the Effect of Four Different Single Bolus Intravenous Doses of FE200440 and Placebo on Stopping Preterm Labor. U.S. National Institutes of Health. | |||||
REF 10 | ClinicalTrials.gov (NCT02545127) Trial Exploring the Efficacy and Safety of FE 202767. | |||||
REF 11 | ClinicalTrials.gov (NCT01021553) A Study To Evaluate the Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of Two Oral Doses of GSK557296 in a Study in Men With Premature Ejaculation. U.S. National Institutes of Health. | |||||
REF 12 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2202). | |||||
REF 13 | Anxiolytic- and antidepressant-like effects of the non-peptide vasopressin V1b receptor antagonist, SSR149415, suggest an innovative approach for t... Proc Natl Acad Sci U S A. 2002 Apr 30;99(9):6370-5. | |||||
REF 14 | Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92. | |||||
REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2249). | |||||
REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010521) | |||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025596) | |||||
REF 18 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010692) | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020775) | |||||
REF 20 | Structural organization of the human oxytocin receptor gene. J Biol Chem. 1994 Dec 23;269(51):32451-6. | |||||
REF 21 | Structure and expression of a human oxytocin receptor. Nature. 1992 Apr 9;356(6369):526-9. | |||||
REF 22 | Design of potent and selective agonists for the human vasopressin V1b receptor based on modifications of [deamino-cys1]arginine vasopressin at position 4. J Med Chem. 2004 Apr 22;47(9):2375-88. | |||||
REF 23 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 369). | |||||
REF 24 | Oxytocin receptors and human parturition: a dual role for oxytocin in the initiation of labor. Science. 1982 Mar 12;215(4538):1396-8. | |||||
REF 25 | Pyridobenzodiazepines: a novel class of orally active, vasopressin V2 receptor selective agonists. Bioorg Med Chem Lett. 2006 Feb 15;16(4):954-9. | |||||
REF 26 | The Effect of an Oxytocin Receptor Antagonist (Retosiban, GSK221149A) on the Response of Human Myometrial Explants to Prolonged Mechanical Stretch.Endocrinology.2015 Oct;156(10):3511-6. | |||||
REF 27 | The effect of barusiban, a selective oxytocin antagonist, in threatened preterm labor at late gestational age: a randomized, double-blind, placebo-controlled trial. Am J Obstet Gynecol. 2009 Jun;200(6):627.e1-10. | |||||
REF 28 | Inhibition of ejaculation by the non-peptide oxytocin receptor antagonist GSK557296: a multi-level site of action. Br J Pharmacol. 2013 Aug;169(7):1477-85. | |||||
REF 29 | Tetrahydroquinoline sulfonamides as vasopressin 1b receptor antagonists. Bioorg Med Chem Lett. 2009 Nov 1;19(21):6018-22. | |||||
REF 30 | A patent review of oxytocin receptor antagonists 2013-2017.Expert Opin Ther Pat. 2017 Dec;27(12):1287-1290. | |||||
REF 31 | Pharmacokinetics and disposition of the oxytocin receptor antagonist L-368,899 in rats and dogs. Drug Metab Dispos. 1997 Oct;25(10):1113-8. | |||||
REF 32 | Oral oxytocin antagonists. J Med Chem. 2010 Sep 23;53(18):6525-38. | |||||
REF 33 | In vivo activity of the potent oxytocin antagonist on uterine activity in the rat. In Vivo. 2004 Nov-Dec;18(6):763-6. | |||||
REF 34 | Clinical pipeline report, company report or official report of darkpharma. | |||||
REF 35 | Design and synthesis of the first selective agonists for the rat vasopressin V(1b) receptor: based on modifications of deamino-[Cys1]arginine vasop... J Med Chem. 2007 Feb 22;50(4):835-47. | |||||
REF 36 | Synthesis and characterization of fluorescent antagonists and agonists for human oxytocin and vasopressin V(1)(a) receptors. J Med Chem. 2002 Jun 6;45(12):2579-88. | |||||
REF 37 | Characterization of the human oxytocin receptor stably expressed in 293 human embryonic kidney cells. Life Sci. 1995;57(24):2253-61. | |||||
REF 38 | Discovery and development of a new class of potent, selective, orally active oxytocin receptor antagonists. J Med Chem. 2005 Dec 1;48(24):7882-905. | |||||
REF 39 | Pharmacology of (2S,4Z)-N-[(2S)-2-hydroxy-2-phenylethyl]-4-(methoxyimino) -1-[(2'-methyl[1,1'-biphenyl]-4-yl)carbonyl]-2-pyrrolidinecarboxamide, a ... J Pharmacol Exp Ther. 2003 Jul;306(1):253-61. | |||||
REF 40 | 2,5-diketopiperazines as potent, selective, and orally bioavailable oxytocin antagonists. 2. Synthesis, chirality, and pharmacokinetics. J Med Chem. 2005 Nov 3;48(22):6956-69. | |||||
REF 41 | SSR126768A (4-chloro-3-[(3R)-(+)-5-chloro-1-(2,4-dimethoxybenzyl)-3-methyl-2-oxo-2,3-dihydro-1H-indol-3-yl]-N-ethyl-N-(3-pyridylmethyl)-benzamide, ... J Pharmacol Exp Ther. 2004 Apr;309(1):414-24. | |||||
REF 42 | A nonpeptide oxytocin receptor antagonist radioligand highly selective for human receptors. Eur J Pharmacol. 2002 Aug 16;450(1):19-28. | |||||
REF 43 | Synthesis and biological activity of oxytocin analogues containing conformationally-restricted residues in position 7. Eur J Med Chem. 2007 Jun;42(6):799-806. | |||||
REF 44 | Toward efficient drug screening by homogeneous assays based on the development of new fluorescent vasopressin and oxytocin receptor ligands. J Med Chem. 2007 Oct 4;50(20):4976-85. | |||||
REF 45 | Two aromatic residues regulate the response of the human oxytocin receptor to the partial agonist arginine vasopressin. FEBS Lett. 1996 Nov 18;397(2-3):201-6. | |||||
REF 46 | [3H]-[Thr4,Gly7]OT: a highly selective ligand for central and peripheral OT receptors. Am J Physiol. 1988 Jan;254(1 Pt 1):E31-8. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.