Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T36059
(Former ID: TTDS00189)
|
|||||
Target Name |
Adenosine A3 receptor (ADORA3)
|
|||||
Synonyms |
Adenosine receptor A3A; Adenosine receptor A3; Adenosine 3 receptor; A3AR; A3 Adenosine receptor
Click to Show/Hide
|
|||||
Gene Name |
ADORA3
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Psoriasis [ICD-11: EA90] | |||||
2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
Function |
The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. Isoform 2: Receptor for adenosine.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC VVCHPSDSLDTSIEKNSE Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T62FNY |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
1 | IB-MECA | Drug Info | Phase 3 | Solid tumour/cancer | [2], [3], [4] | |
2 | CF102 | Drug Info | Phase 2 | Hepatocellular carcinoma | [5] | |
3 | NITD609 | Drug Info | Phase 2 | Malaria | [6] | |
4 | Tonapofylline | Drug Info | Phase 2 | Acute and chronic heart failure | [7] | |
5 | AST-004 | Drug Info | Phase 1 | Stroke | [8] | |
Preclinical Drug(s) | [+] 3 Preclinical Drugs | + | ||||
1 | BAY 60-6583 | Drug Info | Preclinical | Myocardial ischemia | [9] | |
2 | CF502 | Drug Info | Preclinical | Inflammation | [10], [11] | |
3 | CF602 | Drug Info | Preclinical | Inflammation | [11] | |
Discontinued Drug(s) | [+] 2 Discontinued Drugs | + | ||||
1 | DIZOCILPINE | Drug Info | Terminated | Cerebrovascular ischaemia | [12], [13] | |
2 | METHYLTHIOADENOSINE | Drug Info | Terminated | Multiple sclerosis | [14] | |
Mode of Action | [+] 4 Modes of Action | + | ||||
Agonist | [+] 25 Agonist drugs | + | ||||
1 | IB-MECA | Drug Info | [1], [15] | |||
2 | CF102 | Drug Info | [11] | |||
3 | AST-004 | Drug Info | [18] | |||
4 | BAY 60-6583 | Drug Info | [21] | |||
5 | CF502 | Drug Info | [11] | |||
6 | CF602 | Drug Info | [11] | |||
7 | (R,S)-PHPNECA | Drug Info | [26] | |||
8 | (S)-PIA | Drug Info | [27] | |||
9 | 2'-Me-CCPA | Drug Info | [32] | |||
10 | 2-chloroadenosine | Drug Info | [25] | |||
11 | 2-phenylethylyl-adenosine derivative | Drug Info | [46] | |||
12 | AB-MECA | Drug Info | [27] | |||
13 | CP608,039 | Drug Info | [60] | |||
14 | I-ABA | Drug Info | [64] | |||
15 | MPC-MECA | Drug Info | [27] | |||
16 | MRE 3008F20 | Drug Info | [27], [68] | |||
17 | MRS5151 | Drug Info | [74] | |||
18 | MRS5698 | Drug Info | [75] | |||
19 | N(6)-cyclohexyladenosine | Drug Info | [76] | |||
20 | PENECA | Drug Info | [26] | |||
21 | TCPA | Drug Info | [85] | |||
22 | [125I]AB-MECA | Drug Info | [27] | |||
23 | [125I]APNEA | Drug Info | [88] | |||
24 | [3H]HEMADO | Drug Info | [89] | |||
25 | [3H]NECA | Drug Info | [90], [91] | |||
Inhibitor | [+] 164 Inhibitor drugs | + | ||||
1 | NITD609 | Drug Info | [16] | |||
2 | Tonapofylline | Drug Info | [17] | |||
3 | SCH-442416 | Drug Info | [19] | |||
4 | BEMESETRON | Drug Info | [20] | |||
5 | DIZOCILPINE | Drug Info | [20] | |||
6 | METHYLTHIOADENOSINE | Drug Info | [22] | |||
7 | METRIFUDIL | Drug Info | [23] | |||
8 | (+)-BUTACLAMOL | Drug Info | [20] | |||
9 | (2R,3S)-3-(6-Amino-purin-9-yl)-nonan-2-ol | Drug Info | [24] | |||
10 | 1,2-dihydro-2-oxoquinazoline-4-carboxyanilide | Drug Info | [28] | |||
11 | 1-(2-(diethylamino)quinazolin-4-yl)-3-phenylurea | Drug Info | [29] | |||
12 | 1-Allyl-3,7-dihydro-purine-2,6-dione | Drug Info | [30] | |||
13 | 1-Benzyl-1H-1,3,4b,9-tetraaza-fluorene-2,4-dione | Drug Info | [31] | |||
14 | 1-Benzyl-3-methyl-3,7-dihydro-purine-2,6-dione | Drug Info | [30] | |||
15 | 1-Butyl-3,7-dihydro-purine-2,6-dione | Drug Info | [30] | |||
16 | 1-Cyclopentyl-3,7-dihydro-purine-2,6-dione | Drug Info | [30] | |||
17 | 1-Phenethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [30] | |||
18 | 1-phenyl-3-(2-(pyridin-2-yl)quinazolin-4-yl)urea | Drug Info | [29] | |||
19 | 1-phenyl-3-(2-(pyridin-3-yl)quinazolin-4-yl)urea | Drug Info | [29] | |||
20 | 1-phenyl-3-(3-(pyridin-2-yl)isoquinolin-1-yl)urea | Drug Info | [29] | |||
21 | 1-phenyl-3-(quinazolin-4-yl)urea | Drug Info | [29] | |||
22 | 1-Prop-2-ynyl-3,7-dihydro-purine-2,6-dione | Drug Info | [30] | |||
23 | 1-Propyl-3,7-dihydro-purine-2,6-dione | Drug Info | [30] | |||
24 | 2,5'-dichloro-5'-deoxy-N6-cyclopentyladenosine | Drug Info | [33] | |||
25 | 2,6,8-triphenyl-9H-purine | Drug Info | [34] | |||
26 | 2,6-bis(4-chlorophenyl)-9H-purine | Drug Info | [34] | |||
27 | 2,6-bis(4-methoxyphenyl)-9H-purine | Drug Info | [34] | |||
28 | 2,6-bis(4-tolyl)-9H-purine | Drug Info | [34] | |||
29 | 2,6-diphenyl-1-deazapurine | Drug Info | [35] | |||
30 | 2,6-diphenyl-8-(1-ethylpropyl)-1-deazapurine | Drug Info | [35] | |||
31 | 2,6-diphenyl-8-ethyl-1-deazapurine | Drug Info | [35] | |||
32 | 2,6-diphenyl-8-methyl-1-deazapurine | Drug Info | [35] | |||
33 | 2,6-diphenyl-8-tButyl-1-deazapurine | Drug Info | [35] | |||
34 | 2,6-diphenyl-9H-purine | Drug Info | [34] | |||
35 | 2,6-dphenyl-8-propyl-1-deazapurine | Drug Info | [35] | |||
36 | 2-(1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [36] | |||
37 | 2-(1H-imidazo[4,5-c]pyridin-2-yl)quinoxaline | Drug Info | [37] | |||
38 | 2-(2''-indolylethyloxy)adenosine | Drug Info | [38] | |||
39 | 2-(3''(5''-chloro-indolyl)ethyloxy)adenosine | Drug Info | [38] | |||
40 | 2-(3''(7''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [38] | |||
41 | 2-(3''-(4''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [38] | |||
42 | 2-(3''-(5''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [38] | |||
43 | 2-(3''-(5''-fluoro-indolyl)ethyloxy)adenosine | Drug Info | [38] | |||
44 | 2-(3''-(5''-hydroxyindolyl)ethyloxy)adenosine | Drug Info | [38] | |||
45 | 2-(3''-(5''-iodo-indolyl)ethyloxy)adenosine | Drug Info | [38] | |||
46 | 2-(3''-(5''-methoxy-indolyl)ethyloxy)adenosine | Drug Info | [38] | |||
47 | 2-(3''-(6''-bromo-indolyl)ethyloxy)adenosine | Drug Info | [38] | |||
48 | 2-(3''-(6''-chloro-indolyl)ethyloxy)adenosine | Drug Info | [38] | |||
49 | 2-(3''-(benzoimidazole-1''-yl)ethyloxy)adenosine | Drug Info | [38] | |||
50 | 2-(3''-(benzotriazole-1''-yl)ethyloxy)adenosine | Drug Info | [38] | |||
51 | 2-(3''-indolylethyloxy)adenosine | Drug Info | [38] | |||
52 | 2-(3''-pyrrolylethyloxy)adenosine | Drug Info | [38] | |||
53 | 2-(4-chloro-1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [37] | |||
54 | 2-(4-chlorophenyl)-6-phenyl-9H-purine | Drug Info | [34] | |||
55 | 2-(4-ethylthiobenzimidazol-2-yl)quinoxaline | Drug Info | [37] | |||
56 | 2-(4-hydroxypent-1-yl)-N6-methoxyadenosine | Drug Info | [39] | |||
57 | 2-(4-methoxyphenyl)-6-phenyl-9H-purine | Drug Info | [34] | |||
58 | 2-(4-methyl-1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [36] | |||
59 | 2-(4-nitro-1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [37] | |||
60 | 2-(5-chloro-1H-benzo[d]imidazol-2-yl)quinoxaline | Drug Info | [37] | |||
61 | 2-(5-cyano-1-pent-1-ynyl)-N6-methoxyadenosine | Drug Info | [39] | |||
62 | 2-(hex-1-ynyl)-N6-methoxyadenosine | Drug Info | [39] | |||
63 | 2-acetylaminoquinazoline-4-carboxyanilide | Drug Info | [28] | |||
64 | 2-aminoquinazoline-4-carboxy-(4-bromophenyl)amide | Drug Info | [28] | |||
65 | 2-aminoquinazoline-4-carboxyanilide | Drug Info | [28] | |||
66 | 2-azido-N6-methyl-9-(beta-D-ribofuranosyl)adenine | Drug Info | [40] | |||
67 | 2-benzoylaminoquinazoline-4-carboxyanilide | Drug Info | [28] | |||
68 | 2-benzyl-2H-pyrazolo[3,4-c]quinolin-4(5H)-one | Drug Info | [41] | |||
69 | 2-chloro-2'-C-methyl-tecadenoson | Drug Info | [42] | |||
70 | 2-ethyl-4-(thiazol-2-yl)thieno[3,2-d]pyrimidine | Drug Info | [43] | |||
71 | 2-ethynyl-N6-methoxyadenosine | Drug Info | [39] | |||
72 | 2-Phenyl-2H-pyrazolo[4,3-c]quinoline | Drug Info | [44] | |||
73 | 2-phenyl-2H-pyrazolo[4,3-d]pyrimidin-7(6H)-one | Drug Info | [45] | |||
74 | 2-phenylpropoxyadenosine | Drug Info | [38] | |||
75 | 2-tolyl-6-phenyl-9H-purine | Drug Info | [34] | |||
76 | 2-[(4-acetylphenyl)ethynyl]-N6-methoxyadenosine | Drug Info | [39] | |||
77 | 2-[(4-fluorophenyl)ethynyl]-N6-methoxyadenosine | Drug Info | [39] | |||
78 | 3-(3-chloro-1H-pyrazol-5-yl)quinoxalin-2(1H)-one | Drug Info | [36] | |||
79 | 3-Methyl-1-phenethyl-3,7-dihydro-purine-2,6-dione | Drug Info | [30] | |||
80 | 3-noradamantyl-1,3-dipropylxanthine | Drug Info | [47] | |||
81 | 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [48] | |||
82 | 4-Ethoxy-7-((E)-styryl)-furo[3,2-g]chromen-5-one | Drug Info | [49] | |||
83 | 4-Methoxy-2-phenyl-2H-pyrazolo[4,3-c]quinoline | Drug Info | [44] | |||
84 | 4-Methoxy-N-(3-phenyl-isoquinolin-1-yl)-benzamide | Drug Info | [50] | |||
85 | 5,6,7-Trimethyl-2-p-tolyl-chromen-4-one | Drug Info | [51] | |||
86 | 5,7-dibromo-9H-pyrido[3,4-b]indol-6-ol | Drug Info | [52] | |||
87 | 5,7-diphenyl-3H-imidazo[4,5-b]pyridin-2-ol | Drug Info | [35] | |||
88 | 5-Butyl-8-phenyl-3H-[1,2,4]triazolo[5,1-i]purine | Drug Info | [53] | |||
89 | 6-ethylamino-2-(3''-indolyl)ethyloxy)adenosine | Drug Info | [38] | |||
90 | 6-guanidino-2-(3''-indolylethyloxy)adenosine | Drug Info | [38] | |||
91 | 6-Hydroxy-5,7-dimethyl-beta-carboline | Drug Info | [52] | |||
92 | 8-Bromo-9-(3-hydroxypropyl)-9H-adenine | Drug Info | [54] | |||
93 | 8-Bromo-9-(sec-butyl)-9H-adenine | Drug Info | [54] | |||
94 | 8-Bromo-9-cyclobutyl-9H-adenine | Drug Info | [54] | |||
95 | 8-Bromo-9-cyclohexyl-9H-adenine | Drug Info | [54] | |||
96 | 8-Bromo-9-cyclopentyl-9H-adenine | Drug Info | [54] | |||
97 | 8-bromo-9-isobutyl-9H-purin-6-amine | Drug Info | [55] | |||
98 | 8-Bromo-9-isopropyl-9H-adenine | Drug Info | [54] | |||
99 | 8-Hydroxy-5,7,9-trimethyl-delta-carboline | Drug Info | [52] | |||
100 | 8-Hydroxy-7,9-dimethyl-delta-carboline | Drug Info | [52] | |||
101 | 8-PHENYL THEOPHYLLINE | Drug Info | [56] | |||
102 | 8-propyl-2,6-diphenyl-9H-purine | Drug Info | [34] | |||
103 | 9-Cyclopentyl-9H-adenine | Drug Info | [54] | |||
104 | 9-Ethyl-8-phenylethynyl-9H-purin-6-ylamine | Drug Info | [57] | |||
105 | 9H-purine derivative | Drug Info | [20] | |||
106 | CIRSIMARITIN | Drug Info | [51] | |||
107 | Cyclohexyl-(2-phenoxy-9H-purin-6-yl)-amine | Drug Info | [61] | |||
108 | Cyclohexyl-(2-phenylsulfanyl-9H-purin-6-yl)-amine | Drug Info | [61] | |||
109 | Ethyl 5-benzoyl-4-phenylthiazol-2-ylcarbamate | Drug Info | [17] | |||
110 | Galangin | Drug Info | [51] | |||
111 | GNF-PF-2224 | Drug Info | [62] | |||
112 | Hexanoic Acid (2,6-diphenylpyrimidin-4-yl)amide | Drug Info | [63] | |||
113 | isobutylmethylxanthine | Drug Info | [56] | |||
114 | L-249313 | Drug Info | [66] | |||
115 | LUF-5417 | Drug Info | [17] | |||
116 | LUF-5433 | Drug Info | [17] | |||
117 | LUF-5767 | Drug Info | [63] | |||
118 | LUF-5816 | Drug Info | [35] | |||
119 | LUF-5956 | Drug Info | [34] | |||
120 | LUF-5957 | Drug Info | [34] | |||
121 | LUF-5962 | Drug Info | [34] | |||
122 | LUF-5978 | Drug Info | [35] | |||
123 | LUF-5980 | Drug Info | [35] | |||
124 | LUF-5981 | Drug Info | [35] | |||
125 | MESULERGINE | Drug Info | [20] | |||
126 | METHOCTRAMINE | Drug Info | [20] | |||
127 | N*2*-Benzyl-N*6*-cyclohexyl-9H-purine-2,6-diamine | Drug Info | [61] | |||
128 | N*6*-Cyclohexyl-N*2*-ethyl-9H-purine-2,6-diamine | Drug Info | [61] | |||
129 | N*6*-Cyclohexyl-N*2*-phenyl-9H-purine-2,6-diamine | Drug Info | [61] | |||
130 | N*6*-Cyclooctyl-N*2*-phenyl-9H-purine-2,6-diamine | Drug Info | [61] | |||
131 | N-(2,6-diphenylpyrimidin-4-yl)-3-methylbutyramide | Drug Info | [63] | |||
132 | N-(2,6-diphenylpyrimidin-4-yl)acetamide | Drug Info | [63] | |||
133 | N-(2,6-diphenylpyrimidin-4-yl)benzamide | Drug Info | [63] | |||
134 | N-(2,6-diphenylpyrimidin-4-yl)butyramide | Drug Info | [63] | |||
135 | N-(2,6-diphenylpyrimidin-4-yl)isobutyramide | Drug Info | [63] | |||
136 | N-(2,6-diphenylpyrimidin-4-yl)propionamide | Drug Info | [63] | |||
137 | N-(2-(furan-2-yl)-3,4'-bipyridin-6-yl)acetamide | Drug Info | [77] | |||
138 | N-(4,5-diphenylpyrimidin-2-yl)acetamide | Drug Info | [63] | |||
139 | N-(4,6-diphenylpyrimidin-2-yl)-4-chlorobenzamide | Drug Info | [63] | |||
140 | N-(4,6-diphenylpyrimidin-2-yl)propionamide | Drug Info | [63] | |||
141 | N-(5-Benzoyl-4-phenylthiazol-2-yl)benzamide | Drug Info | [17] | |||
142 | N6-((+/-)-endo-norborn-2-yl)adenosine | Drug Info | [33] | |||
143 | N6-(3-Iodobenzyl)-2'-O-methyladenosine | Drug Info | [78] | |||
144 | N6-CYCLOPENTYLADENOSINE | Drug Info | [79] | |||
145 | N6-methoxy-2-phenylethynyladenosine | Drug Info | [39] | |||
146 | N6-methoxy-2-[(2-pyridinyl)ethynyl]adenosine | Drug Info | [39] | |||
147 | N6-methoxy-2-[(3-pyridinyl)ethynyl]-adenosine | Drug Info | [39] | |||
148 | N6-methoxy-2-[(4-methoxyphenyl)ethynyl]adenosine | Drug Info | [39] | |||
149 | N6-methoxy-2-[(4-methylphenyl)ethynyl]adenosine | Drug Info | [39] | |||
150 | N6-methoxy-2-[(4-pentylphenyl)ethynyl]adenosine | Drug Info | [39] | |||
151 | N6-methoxy-2-[(4-pyridinyl)ethynyl]adenosine | Drug Info | [39] | |||
152 | N6-methoxy-2-[2-(trimethylsilyl)ethynyl]adenosine | Drug Info | [39] | |||
153 | NIPECOTIC ACID | Drug Info | [20] | |||
154 | NSC-407228 | Drug Info | [51] | |||
155 | R-N6-(phenylisopropyl)adenosine | Drug Info | [38], [84] | |||
156 | REVERSINE | Drug Info | [61] | |||
157 | SB-298 | Drug Info | [83] | |||
158 | SEROTONIN | Drug Info | [20] | |||
159 | VUF-8504 | Drug Info | [29] | |||
160 | VUF-8507 | Drug Info | [29] | |||
161 | [1,2,4]triazolo[1,5-a]quinoxalin-4(5H)-one | Drug Info | [87] | |||
162 | [3H]CCPA | Drug Info | [42] | |||
163 | [3H]kainate | Drug Info | [20] | |||
164 | [3H]OSIP339391 | Drug Info | [55] | |||
Antagonist | [+] 32 Antagonist drugs | + | ||||
1 | (E)-8-(3-chlorostyryl)-caffeine | Drug Info | [25] | |||
2 | ACN-1052 | Drug Info | [58] | |||
3 | ATL802 | Drug Info | [59] | |||
4 | flavone | Drug Info | [49], [51] | |||
5 | I-ABOPX | Drug Info | [64] | |||
6 | KF26777 | Drug Info | [65] | |||
7 | MRE 2029F20 | Drug Info | [67] | |||
8 | MRE 3010F20 | Drug Info | [27] | |||
9 | MRS-1220 | Drug Info | [69] | |||
10 | MRS1041 | Drug Info | [49] | |||
11 | MRS1042 | Drug Info | [49] | |||
12 | MRS1067 | Drug Info | [70] | |||
13 | MRS1088 | Drug Info | [49] | |||
14 | MRS1093 | Drug Info | [49] | |||
15 | MRS1097 | Drug Info | [71] | |||
16 | MRS1177 | Drug Info | [72] | |||
17 | MRS1186 | Drug Info | [72] | |||
18 | MRS1191 | Drug Info | [58] | |||
19 | MRS1476 | Drug Info | [73] | |||
20 | MRS1486 | Drug Info | [73] | |||
21 | MRS1505 | Drug Info | [73] | |||
22 | MRS1523 | Drug Info | [73] | |||
23 | MRS928 | Drug Info | [49], [51] | |||
24 | PSB-10 | Drug Info | [80] | |||
25 | PSB-11 | Drug Info | [81] | |||
26 | PSB36 | Drug Info | [82] | |||
27 | PSB603 | Drug Info | [83] | |||
28 | sakuranetin | Drug Info | [49] | |||
29 | visnagin | Drug Info | [49] | |||
30 | VUF5574 | Drug Info | [86] | |||
31 | xanthine amine congener | Drug Info | [27] | |||
32 | [3H]PSB-11 | Drug Info | [81] | |||
Enhancer | [+] 1 Enhancer drugs | + | ||||
1 | LUF-5833 | Drug Info | [58] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Human Similarity Proteins
Human Pathway Affiliation
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
cGMP-PKG signaling pathway | hsa04022 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Sphingolipid signaling pathway | hsa04071 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
|
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Adenosine P1 receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 3 WikiPathways | + | ||||
1 | Nucleotide GPCRs | |||||
2 | GPCRs, Class A Rhodopsin-like | |||||
3 | GPCRs, Other |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation | ||||||
Target QSAR Model |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | A role for central A3-adenosine receptors. Mediation of behavioral depressant effects. FEBS Lett. 1993 Dec 20;336(1):57-60. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 422). | |||||
REF 3 | Methotrexate enhances the anti-inflammatory effect of CF101 via up-regulation of the A3 adenosine receptor expression. Arthritis Res Ther. 2006;8(6):R169. | |||||
REF 4 | CF101, an agonist to the A3 adenosine receptor, enhances the chemotherapeutic effect of 5-fluorouracil in a colon carcinoma murine model. Neoplasia. 2005 Jan;7(1):85-90. | |||||
REF 5 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 6 | ClinicalTrials.gov (NCT01836458) A Study to Find the Minimum Inhibitory Concentration of KAE609 in Adult Male Patients With P. Falciparum Monoinfection. U.S. National Institutes of Health. | |||||
REF 7 | Emerging drugs for acute and chronic heart failure: current and future developments. Expert Opin Emerg Drugs. 2007 Mar;12(1):75-95. | |||||
REF 8 | Clinical pipeline report, company report or official report of Astrocyte Pharmaceuticals | |||||
REF 9 | Circadian rhythm as a therapeutic target. Nat Rev Drug Discov. 2021 Apr;20(4):287-307. | |||||
REF 10 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5601). | |||||
REF 11 | 2011 Pipeline of Can-Fite BioPharm. | |||||
REF 12 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2403). | |||||
REF 13 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000713) | |||||
REF 14 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000987) | |||||
REF 15 | A3 adenosine receptor as a target for cancer therapy. Anticancer Drugs. 2002 Jun;13(5):437-43. | |||||
REF 16 | Spiroindolones, a potent compound class for the treatment of malaria. Science. 2010 Sep 3;329(5996):1175-80. | |||||
REF 17 | 2-Amino-5-benzoyl-4-phenylthiazoles: Development of potent and selective adenosine A1 receptor antagonists. Bioorg Med Chem. 2010 Mar 15;18(6):2195-2203. | |||||
REF 18 | Adenosine A1R/A3R (Adenosine A1 and A3 Receptor) Agonist AST-004 Reduces Brain Infarction in a Nonhuman Primate Model of Stroke. Stroke. 2022 Jan;53(1):238-248. | |||||
REF 19 | Synthesis and evaluation of 1,2,4-triazolo[1,5-c]pyrimidine derivatives as A2A receptor-selective antagonists. Bioorg Med Chem Lett. 2010 Oct 1;20(19):5690-4. | |||||
REF 20 | 2-n-Butyl-9-methyl-8-[1,2,3]triazol-2-yl-9H-purin-6-ylamine and analogues as A2A adenosine receptor antagonists. Design, synthesis, and pharmacolog... J Med Chem. 2005 Nov 3;48(22):6887-96. | |||||
REF 21 | Protein kinase C protects preconditioned rabbit hearts by increasing sensitivity of adenosine A2b-dependent signaling during early reperfusion. J Mol Cell Cardiol. 2007 Sep;43(3):262-71. | |||||
REF 22 | Novel amino acid derived natural products from the ascidian Atriolum robustum: identification and pharmacological characterization of a unique aden... J Med Chem. 2004 Apr 22;47(9):2243-55. | |||||
REF 23 | (N)-methanocarba 2,N6-disubstituted adenine nucleosides as highly potent and selective A3 adenosine receptor agonists. J Med Chem. 2005 Mar 24;48(6):1745-58. | |||||
REF 24 | Structure-activity relationships of 9-alkyladenine and ribose-modified adenosine derivatives at rat A3 adenosine receptors. J Med Chem. 1995 May 12;38(10):1720-35. | |||||
REF 25 | A binding site model and structure-activity relationships for the rat A3 adenosine receptor. Mol Pharmacol. 1994 Jun;45(6):1101-11. | |||||
REF 26 | N(6)-alkyl-2-alkynyl derivatives of adenosine as potent and selective agonists at the human adenosine A(3) receptor and a starting point for searching A(2B) ligands. J Med Chem. 2002 Jul 18;45(15):3271-9. | |||||
REF 27 | [(3)H]MRE 3008F20: a novel antagonist radioligand for the pharmacological and biochemical characterization of human A(3) adenosine receptors. Mol Pharmacol. 2000 May;57(5):968-75. | |||||
REF 28 | Scouting human A3 adenosine receptor antagonist binding mode using a molecular simplification approach: from triazoloquinoxaline to a pyrimidine sk... J Med Chem. 2007 Dec 27;50(26):6596-606. | |||||
REF 29 | Pharmacophore based receptor modeling: the case of adenosine A3 receptor antagonists. An approach to the optimization of protein models. J Med Chem. 2006 Jul 13;49(14):4085-97. | |||||
REF 30 | Structure-activity relationships at human and rat A2B adenosine receptors of xanthine derivatives substituted at the 1-, 3-, 7-, and 8-positions. J Med Chem. 2002 May 23;45(11):2131-8. | |||||
REF 31 | Pyrido[2,1-f]purine-2,4-dione derivatives as a novel class of highly potent human A(3) adenosine receptor antagonists. J Med Chem. 2002 Aug 1;45(16):3337-44. | |||||
REF 32 | 2'-C-Methyl analogues of selective adenosine receptor agonists: synthesis and binding studies. J Med Chem. 1998 May 7;41(10):1708-15. | |||||
REF 33 | N6-Cycloalkyl- and N6-bicycloalkyl-C5'(C2')-modified adenosine derivatives as high-affinity and selective agonists at the human A1 adenosine recept... J Med Chem. 2009 Apr 23;52(8):2393-406. | |||||
REF 34 | 2,6-disubstituted and 2,6,8-trisubstituted purines as adenosine receptor antagonists. J Med Chem. 2006 May 18;49(10):2861-7. | |||||
REF 35 | 2,6,8-trisubstituted 1-deazapurines as adenosine receptor antagonists. J Med Chem. 2007 Feb 22;50(4):828-34. | |||||
REF 36 | Derivatives of 4-amino-6-hydroxy-2-mercaptopyrimidine as novel, potent, and selective A3 adenosine receptor antagonists. J Med Chem. 2008 Mar 27;51(6):1764-70. | |||||
REF 37 | 2-(Benzimidazol-2-yl)quinoxalines: a novel class of selective antagonists at human A(1) and A(3) adenosine receptors designed by 3D database search... J Med Chem. 2005 Dec 29;48(26):8253-60. | |||||
REF 38 | Structure-activity relationships of 2,N(6),5'-substituted adenosine derivatives with potent activity at the A2B adenosine receptor. J Med Chem. 2007 Apr 19;50(8):1810-27. | |||||
REF 39 | N6-methoxy-2-alkynyladenosine derivatives as highly potent and selective ligands at the human A3 adenosine receptor. J Med Chem. 2007 Mar 22;50(6):1222-30. | |||||
REF 40 | 2-triazole-substituted adenosines: a new class of selective A3 adenosine receptor agonists, partial agonists, and antagonists. J Med Chem. 2006 Dec 14;49(25):7373-83. | |||||
REF 41 | New 2-arylpyrazolo[3,4-c]quinoline derivatives as potent and selective human A3 adenosine receptor antagonists. Synthesis, pharmacological evaluati... J Med Chem. 2007 Aug 23;50(17):4061-74. | |||||
REF 42 | 5'-Carbamoyl derivatives of 2'-C-methyl-purine nucleosides as selective A1 adenosine receptor agonists: affinity, efficacy, and selectivity for A1 ... Bioorg Med Chem. 2008 Jan 1;16(1):336-53. | |||||
REF 43 | Antagonists of the human adenosine A2A receptor. Part 2: Design and synthesis of 4-arylthieno[3,2-d]pyrimidine derivatives. Bioorg Med Chem Lett. 2008 May 1;18(9):2920-3. | |||||
REF 44 | New 2-arylpyrazolo[4,3-c]quinoline derivatives as potent and selective human A3 adenosine receptor antagonists. J Med Chem. 2005 Jul 28;48(15):5001-8. | |||||
REF 45 | 2-Phenylpyrazolo[4,3-d]pyrimidin-7-one as a new scaffold to obtain potent and selective human A3 adenosine receptor antagonists: new insights into ... J Med Chem. 2009 Dec 10;52(23):7640-52. | |||||
REF 46 | Synthesis and biological evaluation of 2-alkynyl-N6-methyl-5'-N-methylcarboxamidoadenosine derivatives as potent and highly selective agonists for the human adenosine A3 receptor. J Med Chem. 2009 Dec 10;52(23):7897-900. | |||||
REF 47 | Potent and orally bioavailable 8-bicyclo[2.2.2]octylxanthines as adenosine A1 receptor antagonists. J Med Chem. 2006 Nov 30;49(24):7119-31. | |||||
REF 48 | Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97. | |||||
REF 49 | Synthesis and biological activities of flavonoid derivatives as A3 adenosine receptor antagonists. J Med Chem. 1996 Jun 7;39(12):2293-301. | |||||
REF 50 | Substituted 4-phenyl-2-(phenylcarboxamido)-1,3-thiazole derivatives as antagonists for the adenosine A(1) receptor. Bioorg Med Chem Lett. 2001 Aug 6;11(15):2017-9. | |||||
REF 51 | Interactions of flavonoids and other phytochemicals with adenosine receptors. J Med Chem. 1996 Feb 2;39(3):781-8. | |||||
REF 52 | Synthesis of eudistomin D analogues and its effects on adenosine receptors. Bioorg Med Chem. 2008 Apr 1;16(7):3825-30. | |||||
REF 53 | Facile synthesis of fused 1,2,4-triazolo[1,5-c]pyrimidine derivatives as human adenosine A3 receptor ligands. Bioorg Med Chem Lett. 2004 May 17;14(10):2443-6. | |||||
REF 54 | 8-Bromo-9-alkyl adenine derivatives as tools for developing new adenosine A2A and A2B receptors ligands. Bioorg Med Chem. 2009 Apr 1;17(7):2812-22. | |||||
REF 55 | Insights into binding modes of adenosine A(2B) antagonists with ligand-based and receptor-based methods. Eur J Med Chem. 2010 Aug;45(8):3459-71. | |||||
REF 56 | Adenosine receptors: targets for future drugs. J Med Chem. 1982 Mar;25(3):197-207. | |||||
REF 57 | Introduction of alkynyl chains on C-8 of adenosine led to very selective antagonists of the A(3) adenosine receptor. Bioorg Med Chem Lett. 2001 Jul 23;11(14):1931-4. | |||||
REF 58 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 21). | |||||
REF 59 | Anilide derivatives of an 8-phenylxanthine carboxylic congener are highly potent and selective antagonists at human A(2B) adenosine receptors. J Med Chem. 2000 Mar 23;43(6):1165-72. | |||||
REF 60 | Novel N6-substituted adenosine 5'-N-methyluronamides with high selectivity for human adenosine A3 receptors reduce ischemic myocardial injury. Am J Physiol Heart Circ Physiol. 2003 Dec;285(6):H2780-7. | |||||
REF 61 | Reversine and its 2-substituted adenine derivatives as potent and selective A3 adenosine receptor antagonists. J Med Chem. 2005 Jul 28;48(15):4910-8. | |||||
REF 62 | Pyrazolo[1',5':1,6]pyrimido[4,5-d]pyridazin-4(3H)-ones as selective human A(1) adenosine receptor ligands. Bioorg Med Chem. 2010 Nov 15;18(22):7890-9. | |||||
REF 63 | 2,4,6-trisubstituted pyrimidines as a new class of selective adenosine A1 receptor antagonists. J Med Chem. 2004 Dec 16;47(26):6529-40. | |||||
REF 64 | Molecular cloning and characterization of the human A3 adenosine receptor. Proc Natl Acad Sci U S A. 1993 Nov 1;90(21):10365-9. | |||||
REF 65 | KF26777 (2-(4-bromophenyl)-7,8-dihydro-4-propyl-1H-imidazo[2,1-i]purin-5(4H)-one dihydrochloride), a new potent and selective adenosine A3 receptor antagonist. Eur J Pharmacol. 2002 May 31;444(3):133-41. | |||||
REF 66 | The utilization of a unified pharmacophore query in the discovery of new antagonists of the adenosine receptor family. Bioorg Med Chem Lett. 2000 Jan 3;10(1):31-4. | |||||
REF 67 | Design, synthesis, and biological evaluation of new 8-heterocyclic xanthine derivatives as highly potent and selective human A2B adenosine receptor antagonists. J Med Chem. 2004 Mar 11;47(6):1434-47. | |||||
REF 68 | Synthesis and preliminary biological evaluation of [3H]-MRE 3008-F20: the first high affinity radioligand antagonist for the human A3 adenosine receptors. Bioorg Med Chem Lett. 2000 Feb 7;10(3):209-11. | |||||
REF 69 | A(3) adenosine receptor activation attenuates neutrophil function and neutrophil-mediated reperfusion injury. Am J Physiol. 1999 Nov;277(5 Pt 2):H1895-905. | |||||
REF 70 | Pharmacological characterization of novel A3 adenosine receptor-selective antagonists. Neuropharmacology. 1997 Sep;36(9):1157-65. | |||||
REF 71 | Interaction of 1,4-dihydropyridine and pyridine derivatives with adenosine receptors: selectivity for A3 receptors. J Med Chem. 1996 Jul 19;39(15):2980-9. | |||||
REF 72 | Derivatives of the triazoloquinazoline adenosine antagonist (CGS15943) are selective for the human A3 receptor subtype. J Med Chem. 1996 Oct 11;39(21):4142-8. | |||||
REF 73 | Structure-activity relationships and molecular modeling of 3, 5-diacyl-2,4-dialkylpyridine derivatives as selective A3 adenosine receptor antagonists. J Med Chem. 1998 Aug 13;41(17):3186-201. | |||||
REF 74 | Design of (N)-methanocarba adenosine 5'-uronamides as species-independent A3 receptor-selective agonists. Bioorg Med Chem Lett. 2008 May 1;18(9):2813-9. | |||||
REF 75 | Structure-guided design of A(3) adenosine receptor-selective nucleosides: combination of 2-arylethynyl and bicyclo[3.1.0]hexane substitutions. J Med Chem. 2012 May 24;55(10):4847-60. | |||||
REF 76 | Inhibition of TNF-alpha expression by adenosine: role of A3 adenosine receptors. J Immunol. 1996 May 1;156(9):3435-42. | |||||
REF 77 | Discovery of N-(5,6-diarylpyridin-2-yl)amide derivatives as potent and selective A(2B) adenosine receptor antagonists. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1697-700. | |||||
REF 78 | Design, synthesis, and biological evaluation of LNA nucleosides as adenosine A3 receptor ligands. Bioorg Med Chem. 2007 Aug 15;15(16):5440-7. | |||||
REF 79 | Semi-rational design of (north)-methanocarba nucleosides as dual acting A(1) and A(3) adenosine receptor agonists: novel prototypes for cardioprote... J Med Chem. 2005 Dec 29;48(26):8103-7. | |||||
REF 80 | Imidazo[2,1-i]purin-5-ones and related tricyclic water-soluble purine derivatives: potent A(2A)- and A(3)-adenosine receptor antagonists. J Med Chem. 2002 Aug 1;45(16):3440-50. | |||||
REF 81 | [(3)H]8-Ethyl-4-methyl-2-phenyl-(8R)-4,5,7,8-tetrahydro-1H-imidazo[2,1-i]-purin-5-one ([(3)H]PSB-11), a novel high-affinity antagonist radioligand for human A(3) adenosine receptors. Bioorg Med Chem Lett. 2002 Feb 11;12(3):501-3. | |||||
REF 82 | Improving potency, selectivity, and water solubility of adenosine A1 receptor antagonists: xanthines modified at position 3 and related pyrimido[1,2,3-cd]purinediones. ChemMedChem. 2006 Aug;1(8):891-902. | |||||
REF 83 | 1-alkyl-8-(piperazine-1-sulfonyl)phenylxanthines: development and characterization of adenosine A2B receptor antagonists and a new radioligand with... J Med Chem. 2009 Jul 9;52(13):3994-4006. | |||||
REF 84 | Structure-activity relationships for 2-substituted adenosines at A1 and A2 adenosine receptors. Pharmacology. 1993;46(2):91-100. | |||||
REF 85 | N6-cyclopentyl-2-(3-phenylaminocarbonyltriazene-1-yl)adenosine (TCPA), a very selective agonist with high affinity for the human adenosine A1 receptor. J Med Chem. 2003 Apr 10;46(8):1492-503. | |||||
REF 86 | Isoquinoline and quinazoline urea analogues as antagonists for the human adenosine A(3) receptor. J Med Chem. 2000 Jun 1;43(11):2227-38. | |||||
REF 87 | 1,2,4-Triazolo[1,5-a]quinoxaline as a versatile tool for the design of selective human A3 adenosine receptor antagonists: synthesis, biological eva... J Med Chem. 2005 Dec 15;48(25):7932-45. | |||||
REF 88 | Molecular cloning and characterization of an adenosine receptor: the A3 adenosine receptor. Proc Natl Acad Sci U S A. 1992 Aug 15;89(16):7432-6. | |||||
REF 89 | [3H]HEMADO--a novel tritiated agonist selective for the human adenosine A3 receptor. Eur J Pharmacol. 2007 Feb 5;556(1-3):14-8. | |||||
REF 90 | Inhibition of human mast cell activation with the novel selective adenosine A(2B) receptor antagonist 3-isobutyl-8-pyrrolidinoxanthine (IPDX)(2). Biochem Pharmacol. 2001 Nov 1;62(9):1163-73. | |||||
REF 91 | 5'-N-substituted carboxamidoadenosines as agonists for adenosine receptors. J Med Chem. 1999 Apr 22;42(8):1384-92. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.