Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T91696 | Target Info | |||
Target Name | Fibronectin (FN1) | ||||
Synonyms | FN; Cold-insoluble globulin; CIG | ||||
Target Type | Clinical trial Target | ||||
Gene Name | FN1 | ||||
Biochemical Class | Fibronectin protein | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | cAMP-responsive element-binding (CREB) homodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Leucine zipper factors (bZIP) | ||||
Regulation Mechanism | Cyclic AMP stimulates transcription of genes that carry the cAMP-responsive element (CRE,5'TGACGTCA3') in the FN promoter. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
1 | Chromatin Immunoprecipitation Assay | [2] | |||
2 | DNase I Footprint Analysis | [1] | |||
UniProt ID | |||||
Sequence |
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apoptosis regulators | [+] 1 Apoptosis regulators Co-regulated By This TF | + | |||
1 | Apoptosis regulator Bcl-2 (BCL-2) | Successful Target | Target Info | [3] | |
Cytokines / Cytokine receptors | [+] 3 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Interferon-gamma (IFNG) | Successful Target | Target Info | [4] | |
2 | Interleukin 5 receptor alpha (IL5RA) | Successful Target | Target Info | [5] | |
3 | Interleukin-1 beta (IL1B) | Successful Target | Target Info | [6] | |
Fibronectin proteins | [+] 1 Fibronectin proteins Co-regulated By This TF | + | |||
1 | Fibronectin (FN1) | Clinical trial Target | Target Info | [1] | |
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
1 | Gonadotropin-releasing hormone receptor (GNRHR) | Successful Target | Target Info | [7] | |
Glucagons | [+] 1 Glucagons Co-regulated By This TF | + | |||
1 | Vasoactive intestinal polypeptide (VIP) | Literature-reported Target | Target Info | [8] | |
Hormones | [+] 2 Hormones Co-regulated By This TF | + | |||
1 | Erythropoietin (EPO) | Clinical trial Target | Target Info | [9] | |
2 | Parathyroid hormone (PTH) | Successful Target | Target Info | [10] | |
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
1 | T-cell surface glycoprotein CD4 (CD4) | Successful Target | Target Info | [11] | |
Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
1 | Low-density lipoprotein receptor (LDL-R) | Successful Target | Target Info | [12] | |
Oxidoreductases | [+] 2 Oxidoreductases Co-regulated By This TF | + | |||
1 | Cholesterol desmolase (CYP11A1) | Successful Target | Target Info | [13] | |
2 | Dopamine beta hydroxylase (DBH) | Clinical trial Target | Target Info | [14] | |
Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
1 | Tissue-type plasminogen activator (PLAT) | Successful Target | Target Info | [15] | |
Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + | |||
1 | Early growth response protein 1 (EGR-1) | Clinical trial Target | Target Info | [16] | |
Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
1 | Transferrin (TF) | Clinical trial Target | Target Info | [17] | |
TF Name | c-Jun/c-Jun (AP-1) homodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Leucine zipper factors (bZIP) | ||||
Family | AP-1(-like) components | ||||
Subfamily | Jun | ||||
Evidence Score (E-score) | 1 | + | |||
1 | DNase I Footprint Analysis | [1] | |||
UniProt ID | |||||
Sequence |
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Interleukin 5 receptor alpha (IL5RA) | Successful Target | Target Info | [5] | |
2 | Interleukin-5 (IL5) | Successful Target | Target Info | [18] | |
Fibronectin proteins | [+] 1 Fibronectin proteins Co-regulated By This TF | + | |||
1 | Fibronectin (FN1) | Clinical trial Target | Target Info | [1] | |
Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
1 | Low-density lipoprotein receptor (LDL-R) | Successful Target | Target Info | [12] | |
Peptidases | [+] 2 Peptidases Co-regulated By This TF | + | |||
1 | Matrix metalloproteinase-1 (MMP-1) | Successful Target | Target Info | [19] | |
2 | Matrix metalloproteinase-9 (MMP-9) | Clinical trial Target | Target Info | [20] |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Cyclic AMP inhibits fibronectin gene expression in a newly developed granulosa cell line by a mechanism that suppresses cAMP-responsive element-dependent transcriptional activation. J Biol Chem. 1990 Oct 25;265(30):18219-26. | ||||
REF 2 | CRE promoter sites modulate alternative splicing via p300-mediated histone acetylation. RNA Biol. 2014;11(7):865-74. | ||||
REF 3 | Induction of bcl-2 expression by phosphorylated CREB proteins during B-cell activation and rescue from apoptosis. Mol Cell Biol. 1996 Oct;16(10):5546-56. | ||||
REF 4 | The proximal regulatory element of the interferon-gamma promoter mediates selective expression in T cells. J Biol Chem. 1996 Dec 13;271(50):31964-72. | ||||
REF 5 | An AP-1 site in the promoter of the human IL-5R alpha gene is necessary for promoter activity in eosinophilic HL60 cells. FEBS Lett. 1998 Sep 4;434(3):251-4. | ||||
REF 6 | Transcription factors NF-IL6 and CREB recognize a common essential site in the human prointerleukin 1 beta gene. Mol Cell Biol. 1994 Nov;14(11):7285-97. | ||||
REF 7 | Functional mapping of a placenta-specific upstream promoter for human gonadotropin-releasing hormone receptor gene. Endocrinology. 2001 Apr;142(4):1506-16. | ||||
REF 8 | Cyclic AMP- and phorbol ester-induced transcriptional activation are mediated by the same enhancer element in the human vasoactive intestinal peptide gene. J Biol Chem. 1991 Feb 25;266(6):3882-7. | ||||
REF 9 | The transcription factors ATF-1 and CREB-1 bind constitutively to the hypoxia-inducible factor-1 (HIF-1) DNA recognition site. Nucleic Acids Res. 1995 Nov 25;23(22):4542-50. | ||||
REF 10 | A redox factor protein, ref1, is involved in negative gene regulation by extracellular calcium. J Biol Chem. 1994 Nov 11;269(45):27855-62. | ||||
REF 11 | CD4 promoter transactivation by human herpesvirus 6. J Virol. 1998 Nov;72(11):8797-805. | ||||
REF 12 | Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21. | ||||
REF 13 | Regulatory mechanisms of cAMP-dependent and cell-specific expression of human steroidogenic cytochrome P450scc (CYP11A1) gene. Eur J Biochem. 1994 Jun 15;222(3):825-34. | ||||
REF 14 | Noradrenergic-specific transcription of the dopamine beta-hydroxylase gene requires synergy of multiple cis-acting elements including at least two Phox2a-binding sites. J Neurosci. 1998 Oct 15;18(20):8247-60. | ||||
REF 15 | Differential binding of cAMP-responsive-element (CRE)-binding protein-1 and activating transcription factor-2 to a CRE-like element in the human tissue-type plasminogen activator (t-PA) gene promoter correlates with opposite regulation of t-PA by phorbol ester in HT-1080 and HeLa cells. Eur J Biochem. 1996 May 1;237(3):532-8. | ||||
REF 16 | Granulocyte-macrophage colony-stimulating factor and interleukin-3 signaling pathways converge on the CREB-binding site in the human egr-1 promoter. Mol Cell Biol. 1994 Sep;14(9):5975-85. | ||||
REF 17 | Brain-specific expression of the human transferrin gene. Similar elements govern transcription in oligodendrocytes and in a neuronal cell line. J Biol Chem. 1994 Sep 30;269(39):24504-10. | ||||
REF 18 | Identification of transcription factor binding sites important in the regulation of the human interleukin-5 gene. J Biol Chem. 1997 Jun 27;272(26):16453-65. | ||||
REF 19 | Phorbol ester-inducible genes contain a common cis element recognized by a TPA-modulated trans-acting factor. Cell. 1987 Jun 19;49(6):729-39. | ||||
REF 20 | Stimulation of 92-kDa gelatinase B promoter activity by ras is mitogen-activated protein kinase kinase 1-independent and requires multiple transcription factor binding sites including closely spaced PEA3/ets and AP-1 sequences. J Biol Chem. 1996 May 3;271(18):10672-80. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.