Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T65197 | Target Info | |||
Target Name | Erythropoietin Receptor (EPOR) | ||||
Synonyms | Full-length form; EPO-R | ||||
Target Type | Successful Target | ||||
Gene Name | EPOR | ||||
Biochemical Class | Cytokine receptor | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | Sp1 transcription factor (SP1) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys2His2 zinc finger domain | ||||
Family | Ubiquitous factors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Sp1 from erythroid and non-erythroid cells could bind to the Sp1 binding motif. By increasing GATA-1 levels via co-transfection, the hEpoR promoter transactivation in K562 cells and non-erythroid cells, but not in the highly active OCIM1 cells, although GATA-1 mRNA levels were comparable in OCIM1 and K562. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
1 | DNase I Footprint Analysis, Electrophoretic Mobility Shift Assay | [2] | |||
2 | Electrophoretic Mobility Shift Assay, DNase I Footprint Analysis | [1] | |||
UniProt ID | |||||
Sequence |
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSP
LALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTS KEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQ TVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQG LANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVT SGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVS GLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPL SGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQ TITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTS GIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTR REACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTW SYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALS VGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINI SGNGF |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Acyltransferases | [+] 2 Acyltransferases Co-regulated By This TF | + | |||
1 | Glutathione S-transferase P (GSTP1) | Clinical trial Target | Target Info | [3] | |
2 | Lecithin-cholesterol acyltransferase (LCAT) | Clinical trial Target | Target Info | [4] | |
Apolipoproteins | [+] 2 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [5] | |
2 | Apolipoprotein E (APOE) | Clinical trial Target | Target Info | [6] | |
Apoptosis regulators | [+] 1 Apoptosis regulators Co-regulated By This TF | + | |||
1 | Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1) | Clinical trial Target | Target Info | [7] | |
Carbon-nitrogen hydrolases | [+] 1 Carbon-nitrogen hydrolases Co-regulated By This TF | + | |||
1 | Adenosine deaminase (ADA) | Successful Target | Target Info | [8] | |
Caveolin proteins | [+] 1 Caveolin proteins Co-regulated By This TF | + | |||
1 | Caveolin 1 (CAV1) | Literature-reported Target | Target Info | [9] | |
Collagens | [+] 1 Collagens Co-regulated By This TF | + | |||
1 | Collagen I (COL1A2) | Clinical trial Target | Target Info | [10] | |
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Erythropoietin Receptor (EPOR) | Successful Target | Target Info | [1] | |
2 | Interferon-gamma (IFNG) | Successful Target | Target Info | [11] | |
Ester hydrolases | [+] 2 Ester hydrolases Co-regulated By This TF | + | |||
1 | Acetylcholinesterase (AChE) | Successful Target | Target Info | [12] | |
2 | M-phase inducer phosphatase 3 (MPIP3) | Literature-reported Target | Target Info | [13] | |
G protein-coupled receptors | [+] 3 G protein-coupled receptors Co-regulated By This TF | + | |||
1 | 5-HT 1A receptor (HTR1A) | Successful Target | Target Info | [14] | |
2 | C-X-C chemokine receptor type 4 (CXCR4) | Successful Target | Target Info | [15] | |
3 | Thromboxane A2 receptor (TBXA2R) | Successful Target | Target Info | [16] | |
Glycoproteins | [+] 2 Glycoproteins Co-regulated By This TF | + | |||
1 | Cholesteryl ester transfer protein (CETP) | Clinical trial Target | Target Info | [17] | |
2 | Tracheobronchial mucin 5A (MUC5AC) | Literature-reported Target | Target Info | [18] | |
Growth factors | [+] 4 Growth factors Co-regulated By This TF | + | |||
1 | Platelet-derived growth factor A (PDGFA) | Clinical trial Target | Target Info | [19] | |
2 | Platelet-derived growth factor B (PDGFB) | Clinical trial Target | Target Info | [20] | |
3 | Thrombomodulin (THBD) | Discontinued Target | Target Info | [21] | |
4 | Transforming growth factor beta 1 (TGFB1) | Successful Target | Target Info | [22] | |
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
1 | Intercellular adhesion molecule ICAM-1 (ICAM1) | Successful Target | Target Info | [23] | |
Integrins | [+] 1 Integrins Co-regulated By This TF | + | |||
1 | Integrin alpha-2 (ITGA2) | Clinical trial Target | Target Info | [24] | |
Kinases | [+] 5 Kinases Co-regulated By This TF | + | |||
1 | Casein kinase II alpha (CSNK2A1) | Clinical trial Target | Target Info | [25] | |
2 | Epidermal growth factor receptor (EGFR) | Successful Target | Target Info | [26] | |
3 | Serine/threonine-protein kinase pim-1 (PIM1) | Clinical trial Target | Target Info | [27] | |
4 | Telomerase reverse transcriptase (TERT) | Clinical trial Target | Target Info | [28] | |
5 | Thymidine kinase 1 (TK1) | Successful Target | Target Info | [29] | |
Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
1 | Low-density lipoprotein receptor (LDL-R) | Successful Target | Target Info | [30] | |
Lyases | [+] 2 Lyases Co-regulated By This TF | + | |||
1 | Histidine decarboxylase (HDC) | Clinical trial Target | Target Info | [31] | |
2 | Leukotriene C4 synthase (LTC4S) | Patented-recorded Target | Target Info | [32] | |
Nuclear hormone receptors | [+] 2 Nuclear hormone receptors Co-regulated By This TF | + | |||
1 | Hepatocyte nuclear factor 4-alpha (HNF4A) | Literature-reported Target | Target Info | [33] | |
2 | Progesterone receptor (PGR) | Successful Target | Target Info | [34] | |
Oxidoreductases | [+] 9 Oxidoreductases Co-regulated By This TF | + | |||
1 | Arachidonate 12-lipoxygenase (12-LOX) | Literature-reported Target | Target Info | [35] | |
2 | Bacterial Triosephosphate isomerase (Bact TPI) | Literature-reported Target | Target Info | [36] | |
3 | Catalase (CAT) | Clinical trial Target | Target Info | [37] | |
4 | Cholesterol desmolase (CYP11A1) | Successful Target | Target Info | [38] | |
5 | Dopamine beta hydroxylase (DBH) | Clinical trial Target | Target Info | [39] | |
6 | Estradiol 17 beta-dehydrogenase 1 (17-beta-HSD1) | Clinical trial Target | Target Info | [40] | |
7 | Heme oxygenase 1 (HMOX1) | Clinical trial Target | Target Info | [41] | |
8 | Nitric-oxide synthase endothelial (NOS3) | Clinical trial Target | Target Info | [42] | |
9 | Superoxide dismutase Cu-Zn (SOD Cu-Zn) | Clinical trial Target | Target Info | [43] | |
Peptidases | [+] 4 Peptidases Co-regulated By This TF | + | |||
1 | Caspase-8 (CASP8) | Patented-recorded Target | Target Info | [44] | |
2 | Cathepsin D (CTSD) | Clinical trial Target | Target Info | [45] | |
3 | Dibasic-processing enzyme (Furin) | Preclinical Target | Target Info | [46] | |
4 | Neutral endopeptidase (MME) | Clinical trial Target | Target Info | [47] | |
Pro-neuropeptides | [+] 1 Pro-neuropeptides Co-regulated By This TF | + | |||
1 | Neuropeptide Y (NPY) | Literature-reported Target | Target Info | [48] | |
Small GTPases | [+] 1 Small GTPases Co-regulated By This TF | + | |||
1 | GTPase HRas (HRAS) | Literature-reported Target | Target Info | [49] | |
Somatotropin / Prolactins | [+] 1 Somatotropin / Prolactins Co-regulated By This TF | + | |||
1 | Somatotropin (GH1) | Clinical trial Target | Target Info | [50] | |
Transcription factors | [+] 2 Transcription factors Co-regulated By This TF | + | |||
1 | Transcription factor Sp1 (SP1) | Clinical trial Target | Target Info | [51] | |
2 | Wilms tumor protein (WT1) | Clinical trial Target | Target Info | [52] | |
Transferrins | [+] 1 Transferrins Co-regulated By This TF | + | |||
1 | Transferrin (TF) | Clinical trial Target | Target Info | [53] | |
Zinc-fingers | [+] 1 Zinc-fingers Co-regulated By This TF | + | |||
1 | Utrophin (UTRN) | Clinical trial Target | Target Info | [54] | |
TF Name | Erythroid transcription factor (Eryf1) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | diverse Cys4 zinc fingers | ||||
Family | GATA-Factors | ||||
Subfamily | vertebral GATA-Factors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | Sp1 from erythroid and non-erythroid cells could bind to the Sp1 binding motif. By increasing GATA-1 levels via co-transfection, the hEpoR promoter transactivation in K562 cells and non-erythroid cells, but not in the highly active OCIM1 cells, although GATA-1 mRNA levels were comparable in OCIM1 and K562. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
1 | DNase I Footprint Analysis, Electrophoretic Mobility Shift Assay | [2] | |||
2 | Electrophoretic Mobility Shift Assay, DNase I Footprint Analysis | [1] | |||
UniProt ID | |||||
Sequence |
MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAAL
AYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQA VEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPL NSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP LIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGT AHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Erythropoietin Receptor (EPOR) | Successful Target | Target Info | [1] | |
2 | Interferon-gamma (IFNG) | Successful Target | Target Info | [55] | |
Glycoproteins | [+] 1 Glycoproteins Co-regulated By This TF | + | |||
1 | von Willebrand factor (VWF) | Successful Target | Target Info | [56] | |
Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + | |||
1 | Wilms tumor protein (WT1) | Clinical trial Target | Target Info | [57] |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Regulation of transcription of the human erythropoietin receptor gene by proteins binding to GATA-1 and Sp1 motifs. Nucleic Acids Res. 1995 Aug 11;23(15):3041-9. | ||||
REF 2 | Different domains regulate the human erythropoietin receptor gene transcription. Nucleic Acids Res. 1994 Feb 11;22(3):338-46. | ||||
REF 3 | Sp1-mediated transcriptional activation of the human Pi class glutathione S-transferase promoter. J Biol Chem. 1996 Jan 12;271(2):1054-60. | ||||
REF 4 | Binding and functional effects of transcription factors Sp1 and Sp3 on the proximal human lecithin:cholesterol acyltransferase promoter. J Lipid Res. 1998 May;39(5):969-77. | ||||
REF 5 | Involvement of early growth response factor Egr-1 in apolipoprotein AI gene transcription. J Biol Chem. 1995 Mar 24;270(12):7004-10. | ||||
REF 6 | Characterization of a human apolipoprotein E gene enhancer element and its associated protein factors. J Biol Chem. 1990 Jun 5;265(16):9496-504. | ||||
REF 7 | Regulation of MCL1 through a serum response factor/Elk-1-mediated mechanism links expression of a viability-promoting member of the BCL2 family to the induction of hematopoietic cell differentiation. J Biol Chem. 1999 Jan 15;274(3):1801-13. | ||||
REF 8 | Sp1 is essential for both enhancer-mediated and basal activation of the TATA-less human adenosine deaminase promoter. Nucleic Acids Res. 1994 Feb 25;22(4):669-77. | ||||
REF 9 | Intracellular cholesterol transport in synchronized human skin fibroblasts. Biochemistry. 1999 Feb 23;38(8):2506-13. | ||||
REF 10 | Transforming growth factor-beta stimulates alpha 2(I) collagen gene expression through a cis-acting element that contains an Sp1-binding site. J Biol Chem. 1994 May 20;269(20):14828-34. | ||||
REF 11 | The nuclear factor YY1 suppresses the human gamma interferon promoter through two mechanisms: inhibition of AP1 binding and activation of a silence... Mol Cell Biol. 1996 Sep;16(9):4744-53. | ||||
REF 12 | Transcription factor repression and activation of the human acetylcholinesterase gene. J Biol Chem. 1995 Oct 6;270(40):23511-9. | ||||
REF 13 | Cell cycle regulation of cdc25C transcription is mediated by the periodic repression of the glutamine-rich activators NF-Y and Sp1. Nucleic Acids Res. 1995 Oct 11;23(19):3822-30. | ||||
REF 14 | The serotonin 1a receptor gene contains a TATA-less promoter that responds to MAZ and Sp1. J Biol Chem. 1996 Feb 23;271(8):4417-30. | ||||
REF 15 | Genomic organization and functional characterization of the chemokine receptor CXCR4, a major entry co-receptor for human immunodeficiency virus type 1. J Biol Chem. 1998 Feb 20;273(8):4754-60. | ||||
REF 16 | Novel role for Sp1 in phorbol ester enhancement of human platelet thromboxane receptor gene expression. J Biol Chem. 1996 Aug 16;271(33):19696-704. | ||||
REF 17 | Transcriptional regulation of the cholesteryl ester transfer protein gene by the orphan nuclear hormone receptor apolipoprotein AI regulatory protein-1. J Biol Chem. 1995 Dec 15;270(50):29916-22. | ||||
REF 18 | The human uncoupling protein-3 gene promoter requires MyoD and is induced by retinoic acid in muscle cells. FASEB J. 2000 Nov;14(14):2141-3. | ||||
REF 19 | The Wilms' tumor gene product, WT1, represses transcription of the platelet-derived growth factor A-chain gene. J Biol Chem. 1992 Nov 5;267(31):21999-2002. | ||||
REF 20 | Identification of a thrombin response element in the human platelet-derived growth factor B-chain (c-sis) promoter. J Biol Chem. 1996 Feb 9;271(6):3025-32. | ||||
REF 21 | Acceleration of thrombomodulin gene transcription by retinoic acid: retinoic acid receptors and Sp1 regulate the promoter activity through interactions with two different sequences in the 5'-flanking region of human gene. J Biol Chem. 2001 Jan 26;276(4):2440-50. | ||||
REF 22 | Regulation of the transforming growth factor-beta 1 and -beta 3 promoters by transcription factor Sp1. Gene. 1993 Jul 30;129(2):223-8. | ||||
REF 23 | Stat1 depends on transcriptional synergy with Sp1. J Biol Chem. 1995 Dec 22;270(51):30264-7. | ||||
REF 24 | Binding of phosphorylated Sp1 protein to tandem Sp1 binding sites regulates alpha2 integrin gene core promoter activity. Blood. 1997 Jul 15;90(2):678-89. | ||||
REF 25 | Transcription factors ets1, NF-kappa B, and Sp1 are major determinants of the promoter activity of the human protein kinase CK2alpha gene. J Biol Chem. 2000 Jun 16;275(24):18327-36. | ||||
REF 26 | Identification of an estrogen-mediated deoxyribonucleic acid-binding independent transactivation pathway on the epidermal growth factor receptor gene promoter. Endocrinology. 2000 Jun;141(6):2266-74. | ||||
REF 27 | The human Pim-1 gene is selectively transcribed in different hemato-lymphoid cell lines in spite of a G + C-rich housekeeping promoter. Mol Cell Biol. 1990 Apr;10(4):1680-8. | ||||
REF 28 | Sp1 cooperates with c-Myc to activate transcription of the human telomerase reverse transcriptase gene (hTERT). Nucleic Acids Res. 2000 Feb 1;28(3):669-77. | ||||
REF 29 | Constitutive protection of E2F recognition sequences in the human thymidine kinase promoter during cell cycle progression. J Biol Chem. 1997 Nov 28;272(48):30483-90. | ||||
REF 30 | Co-stimulation of promoter for low density lipoprotein receptor gene by sterol regulatory element-binding protein and Sp1 is specifically disrupted by the yin yang 1 protein. J Biol Chem. 1999 May 7;274(19):13025-32. | ||||
REF 31 | Mast cell-/basophil-specific transcriptional regulation of human L-histidine decarboxylase gene by CpG methylation in the promoter region. J Biol Chem. 1998 Nov 20;273(47):31607-14. | ||||
REF 32 | Cell-specific transcription of leukotriene C(4) synthase involves a Kruppel-like transcription factor and Sp1. J Biol Chem. 2000 Mar 24;275(12):8903-10. | ||||
REF 33 | Regulatory mechanisms controlling human hepatocyte nuclear factor 4alpha gene expression. Mol Cell Biol. 2001 Nov;21(21):7320-30. | ||||
REF 34 | Sp1 binding sites and an estrogen response element half-site are involved in regulation of the human progesterone receptor A promoter. Mol Endocrinol. 2000 Jul;14(7):972-85. | ||||
REF 35 | Transcriptional activation of human 12-lipoxygenase gene promoter is mediated through Sp1 consensus sites in A431 cells. Biochem J. 1997 May 15;324 ( Pt 1):133-40. | ||||
REF 36 | Minimal sequence and factor requirements for the initiation of transcription from an atypical, TATATAA box-containing housekeeping promoter. J Biol Chem. 1990 Nov 25;265(33):20524-32. | ||||
REF 37 | Regulation of the catalase gene promoter by Sp1, CCAAT-recognizing factors, and a WT1/Egr-related factor in hydrogen peroxide-resistant HP100 cells. Cancer Res. 2001 Aug 1;61(15):5885-94. | ||||
REF 38 | Actions of two different cAMP-responsive sequences and an enhancer of the human CYP11A1 (P450scc) gene in adrenal Y1 and placental JEG-3 cells. J Biol Chem. 1994 Mar 4;269(9):6362-9. | ||||
REF 39 | Noradrenergic-specific transcription of the dopamine beta-hydroxylase gene requires synergy of multiple cis-acting elements including at least two Phox2a-binding sites. J Neurosci. 1998 Oct 15;18(20):8247-60. | ||||
REF 40 | The proximal promoter region of the gene encoding human 17beta-hydroxysteroid dehydrogenase type 1 contains GATA, AP-2, and Sp1 response elements: analysis of promoter function in choriocarcinoma cells. Endocrinology. 1997 Aug;138(8):3417-25. | ||||
REF 41 | Co-operation of the transcription factor hepatocyte nuclear factor-4 with Sp1 or Sp3 leads to transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line. Biochem J. 2002 Nov 1;367(Pt 3):641-52. | ||||
REF 42 | Transcriptional regulation of endothelial nitric-oxide synthase by lysophosphatidylcholine. J Biol Chem. 1998 Jun 12;273(24):14885-90. | ||||
REF 43 | Sp1 and C/EBP-related factor regulate the transcription of human Cu/Zn SOD gene. Gene. 1996 Oct 31;178(1-2):177-85. | ||||
REF 44 | The human caspase-8 promoter sustains basal activity through SP1 and ETS-like transcription factors and can be up-regulated by a p53-dependent mechanism. J Biol Chem. 2003 Jul 25;278(30):27593-604. | ||||
REF 45 | Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells. J Biol Chem. 1994 Jun 3;269(22):15912-7. | ||||
REF 46 | Expression of the dibasic proprotein processing enzyme furin is directed by multiple promoters. J Biol Chem. 1994 Mar 25;269(12):9298-303. | ||||
REF 47 | Cloning and functional characterization of the 5' flanking region of the human mitochondrial malic enzyme gene. Regulatory role of Sp1 and AP-2. Eur J Biochem. 2001 May;268(10):3017-27. | ||||
REF 48 | Transcriptional regulation of the human neuropeptide Y gene by nerve growth factor. J Biol Chem. 1994 Jun 3;269(22):15460-8. | ||||
REF 49 | Effect of abasic linker substitution on triplex formation, Sp1 binding, and specificity in an oligonucleotide targeted to the human Ha-ras promoter. Nucleic Acids Res. 1994 May 25;22(10):1909-16. | ||||
REF 50 | Sp1 and thyroid hormone receptor differentially activate expression of human growth hormone and chorionic somatomammotropin genes. J Biol Chem. 1991 May 25;266(15):9805-13. | ||||
REF 51 | Cloning and characterization of the 5'-flanking region of the human transcription factor Sp1 gene. J Biol Chem. 2001 Jun 22;276(25):22126-32. | ||||
REF 52 | Characterization of the transcriptional regulatory region of the human WT1 gene. Oncogene. 1993 Nov;8(11):3123-32. | ||||
REF 53 | YY1 and Sp1 transcription factors bind the human transferrin gene in an age-related manner. J Gerontol A Biol Sci Med Sci. 1996 Jan;51(1):B66-75. | ||||
REF 54 | Sp1 and Sp3 physically interact and co-operate with GABP for the activation of the utrophin promoter. J Mol Biol. 2001 Mar 9;306(5):985-96. | ||||
REF 55 | Two essential regulatory elements in the human interferon gamma promoter confer activation specific expression in T cells. J Exp Med. 1993 Nov 1;178(5):1483-96. | ||||
REF 56 | Endothelial-cell-specific regulation of von Willebrand factor gene expression. Mol Cell Biol. 1994 Feb;14(2):999-1008. | ||||
REF 57 | Transactivation of an intronic hematopoietic-specific enhancer of the human Wilms' tumor 1 gene by GATA-1 and c-Myb. J Biol Chem. 1997 Nov 14;272(46):29272-80. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.