Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T32348 Target Info
Target Name Early growth response protein 1 (EGR-1)
Synonyms Zinc finger protein Krox24; Zinc finger protein Krox-24; Zinc finger protein 225; ZNF225; Transcription factor Zif268; Transcription factor ETR103; Nerve growth factorinduced protein A; Nerve growth factor-induced protein A; NGFIA; NGFI-A; KROX24; AT225
Target Type Clinical trial Target
Gene Name EGR1
Biochemical Class EGR C2H2-type zinc-finger
UniProt ID
EGR1_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name cAMP-responsive element-binding (CREB) homodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Regulation Type Increase
Regulation Mechanism Electrophoretic mobility shift assays performed with CREB antibody confirmed the presence of CREB in the DNA-binding complex of the EGR1 gene. [1]
Evidence Score (E-score) 2 +
1 Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay [1]
2 Electrophoretic Mobility Shift Assay [3]
UniProt ID
CREB1_HUMAN
Sequence
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apoptosis regulators [+] 1 Apoptosis regulators Co-regulated By This TF +
1 Apoptosis regulator Bcl-2 (BCL-2) Successful Target Target Info [4]
Cytokines / Cytokine receptors [+] 3 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interferon-gamma (IFNG) Successful Target Target Info [5]
2 Interleukin 5 receptor alpha (IL5RA) Successful Target Target Info [6]
3 Interleukin-1 beta (IL1B) Successful Target Target Info [7]
Fibronectin proteins [+] 1 Fibronectin proteins Co-regulated By This TF +
1 Fibronectin (FN1) Clinical trial Target Target Info [8]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Gonadotropin-releasing hormone receptor (GNRHR) Successful Target Target Info [9]
Glucagons [+] 1 Glucagons Co-regulated By This TF +
1 Vasoactive intestinal polypeptide (VIP) Literature-reported Target Target Info [10]
Hormones [+] 2 Hormones Co-regulated By This TF +
1 Erythropoietin (EPO) Clinical trial Target Target Info [11]
2 Parathyroid hormone (PTH) Successful Target Target Info [12]
Immunoglobulins [+] 1 Immunoglobulins Co-regulated By This TF +
1 T-cell surface glycoprotein CD4 (CD4) Successful Target Target Info [13]
Lipoprotein receptors [+] 1 Lipoprotein receptors Co-regulated By This TF +
1 Low-density lipoprotein receptor (LDL-R) Successful Target Target Info [14]
Oxidoreductases [+] 2 Oxidoreductases Co-regulated By This TF +
1 Cholesterol desmolase (CYP11A1) Successful Target Target Info [15]
2 Dopamine beta hydroxylase (DBH) Clinical trial Target Target Info [16]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Tissue-type plasminogen activator (PLAT) Successful Target Target Info [17]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Early growth response protein 1 (EGR-1) Clinical trial Target Target Info [1]
Transferrins [+] 1 Transferrins Co-regulated By This TF +
1 Transferrin (TF) Clinical trial Target Target Info [18]
TF Name Early growth response protein 1 (EGR1)
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys2His2 zinc finger domain
Family Developmental / cell cycle regulators
Subfamily Egr/Krox
Regulation Type Increase
Regulation Mechanism The EGR1 protein may further stimulate transcription of the EGR1 gene in response to GM-CSF as a secondary event. [1]
Evidence Score (E-score) 1 +
1 Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay [1]
UniProt ID
EGR1_HUMAN
Sequence
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI
EIC
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 1 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-I (APOA1) Clinical trial Target Target Info [19]
Growth factors [+] 2 Growth factors Co-regulated By This TF +
1 Platelet-derived growth factor A (PDGFA) Clinical trial Target Target Info [20]
2 Platelet-derived growth factor B (PDGFB) Clinical trial Target Target Info [21]
Immunoglobulins [+] 1 Immunoglobulins Co-regulated By This TF +
1 B-lymphocyte surface antigen B4 (CD19) Successful Target Target Info [22]
Kinases [+] 1 Kinases Co-regulated By This TF +
1 Epidermal growth factor receptor (EGFR) Successful Target Target Info [23]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Superoxide dismutase Cu-Zn (SOD Cu-Zn) Clinical trial Target Target Info [24]
Transcription factors [+] 2 Transcription factors Co-regulated By This TF +
1 Cellular tumor antigen p53 (TP53) Clinical trial Target Target Info [25]
2 Early growth response protein 1 (EGR-1) Clinical trial Target Target Info [1]
TF Name Serum response factor (SRF) homodimer
Classification Superclass beta-Scaffold Factors with Minor Groove Contacts
Class MADS box
Family Responders to external signals
Regulation Mechanism Transient transfections of NFS60 cells with recombinant constructs containing various deletions of the human EGR1 promoter identified the SRE between nucleotides (nt) -418 and -391 as a critical G-CSF-responsive sequence. The SRE contains a CArG box, the binding site for the SRF. [2]
Evidence Score (E-score) 1 +
1 Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay [2]
UniProt ID
SRF_HUMAN
Sequence
MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREA
AAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAA
TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG
TQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG
FEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI
QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAV
IGQQAGSSSNLTELQVVNLDTAHSTKSE
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apoptosis regulators [+] 1 Apoptosis regulators Co-regulated By This TF +
1 Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1) Clinical trial Target Target Info [26]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Early growth response protein 1 (EGR-1) Clinical trial Target Target Info [2]
References  Top
REF 1 Granulocyte-macrophage colony-stimulating factor and interleukin-3 signaling pathways converge on the CREB-binding site in the human egr-1 promoter. Mol Cell Biol. 1994 Sep;14(9):5975-85.
REF 2 Granulocyte colony-stimulating factor induces Egr-1 up-regulation through interaction of serum response element-binding proteins. J Biol Chem. 2000 Jul 21;275(29):22418-26.
REF 3 Mechanism of transcriptional activation of the immediate early gene Egr-1 in response to PIXY321. Blood. 1996 Aug 1;88(3):848-54.
REF 4 Induction of bcl-2 expression by phosphorylated CREB proteins during B-cell activation and rescue from apoptosis. Mol Cell Biol. 1996 Oct;16(10):5546-56.
REF 5 The proximal regulatory element of the interferon-gamma promoter mediates selective expression in T cells. J Biol Chem. 1996 Dec 13;271(50):31964-72.
REF 6 An AP-1 site in the promoter of the human IL-5R alpha gene is necessary for promoter activity in eosinophilic HL60 cells. FEBS Lett. 1998 Sep 4;434(3):251-4.
REF 7 Transcription factors NF-IL6 and CREB recognize a common essential site in the human prointerleukin 1 beta gene. Mol Cell Biol. 1994 Nov;14(11):7285-97.
REF 8 Cyclic AMP inhibits fibronectin gene expression in a newly developed granulosa cell line by a mechanism that suppresses cAMP-responsive element-dependent transcriptional activation. J Biol Chem. 1990 Oct 25;265(30):18219-26.
REF 9 Functional mapping of a placenta-specific upstream promoter for human gonadotropin-releasing hormone receptor gene. Endocrinology. 2001 Apr;142(4):1506-16.
REF 10 Cyclic AMP- and phorbol ester-induced transcriptional activation are mediated by the same enhancer element in the human vasoactive intestinal peptide gene. J Biol Chem. 1991 Feb 25;266(6):3882-7.
REF 11 The transcription factors ATF-1 and CREB-1 bind constitutively to the hypoxia-inducible factor-1 (HIF-1) DNA recognition site. Nucleic Acids Res. 1995 Nov 25;23(22):4542-50.
REF 12 A redox factor protein, ref1, is involved in negative gene regulation by extracellular calcium. J Biol Chem. 1994 Nov 11;269(45):27855-62.
REF 13 CD4 promoter transactivation by human herpesvirus 6. J Virol. 1998 Nov;72(11):8797-805.
REF 14 Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21.
REF 15 Regulatory mechanisms of cAMP-dependent and cell-specific expression of human steroidogenic cytochrome P450scc (CYP11A1) gene. Eur J Biochem. 1994 Jun 15;222(3):825-34.
REF 16 Noradrenergic-specific transcription of the dopamine beta-hydroxylase gene requires synergy of multiple cis-acting elements including at least two Phox2a-binding sites. J Neurosci. 1998 Oct 15;18(20):8247-60.
REF 17 Differential binding of cAMP-responsive-element (CRE)-binding protein-1 and activating transcription factor-2 to a CRE-like element in the human tissue-type plasminogen activator (t-PA) gene promoter correlates with opposite regulation of t-PA by phorbol ester in HT-1080 and HeLa cells. Eur J Biochem. 1996 May 1;237(3):532-8.
REF 18 Brain-specific expression of the human transferrin gene. Similar elements govern transcription in oligodendrocytes and in a neuronal cell line. J Biol Chem. 1994 Sep 30;269(39):24504-10.
REF 19 Involvement of early growth response factor Egr-1 in apolipoprotein AI gene transcription. J Biol Chem. 1995 Mar 24;270(12):7004-10.
REF 20 The Wilms' tumor gene product, WT1, represses transcription of the platelet-derived growth factor A-chain gene. J Biol Chem. 1992 Nov 5;267(31):21999-2002.
REF 21 c-sis/PDGF-B promoter transactivation by the Yax protein of human T-cell leukemia virus type 1. J Biol Chem. 1996 Jun 14;271(24):14584-90.
REF 22 In vivo footprinting and mutational analysis of the proximal CD19 promoter reveal important roles for an SP1/Egr-1 binding site and a novel site termed the PyG box. J Immunol. 1997 Aug 1;159(3):1284-92.
REF 23 Early Growth Response-1 gene mediates up-regulation of epidermal growth factor receptor expression during hypoxia. Cancer Res. 2002 Feb 1;62(3):827-34.
REF 24 The human copper-zinc superoxide dismutase gene (SOD1) proximal promoter is regulated by Sp1, Egr-1, and WT1 via non-canonical binding sites. J Biol Chem. 1999 Jan 1;274(1):503-9.
REF 25 Early growth response-1-dependent apoptosis is mediated by p53. J Biol Chem. 1997 Aug 8;272(32):20131-8.
REF 26 Regulation of MCL1 through a serum response factor/Elk-1-mediated mechanism links expression of a viability-promoting member of the BCL2 family to the induction of hematopoietic cell differentiation. J Biol Chem. 1999 Jan 15;274(3):1801-13.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.