Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T73475
|
||||
Former ID |
TTDR00029
|
||||
Target Name |
Matrilysin
|
||||
Gene Name |
MMP7
|
||||
Synonyms |
MMP-7; Matrin; Matrix metalloproteinase-7; Pump-1 protease; Uterine metalloproteinase; MMP7
|
||||
Target Type |
Successful
|
||||
Disease | Brain cancer [ICD9: 191, 225.0; ICD10: C71, D33] | ||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Lung cancer; Prostate cancer [ICD9: 140-229, 162, 185; ICD10: C33-C34, C61] | |||||
Non-small-cell lung cancer; Hormone-refractory prostate cancer; Kaposi's sarcoma [ICD9: 140-229, 162, 176, 185, 204.0; ICD10: C33, C33-C34, C34, C46, C61, C91.0] | |||||
Pancreatic cancer; Lung cancer [ICD9: 140-229, 157, 162; ICD10: C25, C33-C34] | |||||
Pancreatic cancer [ICD9: 140-199, 140-229, 157, 210-229; ICD10: C25] | |||||
Function |
Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase.
|
||||
BioChemical Class |
Peptidase
|
||||
Target Validation |
T73475
|
||||
UniProt ID | |||||
EC Number |
EC 3.4.24.23
|
||||
Sequence |
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD PQNFKLSQDDIKGIQKLYGKRSNSRKK |
||||
Drugs and Mode of Action | |||||
Drug(s) | Prinomastat | Drug Info | Approved | Lung cancer; Prostate cancer | [1], [2] |
Marimastat | Drug Info | Phase 3 | Pancreatic cancer | [3], [4] | |
BMS 275291 | Drug Info | Discontinued in Phase 3 | Non-small-cell lung cancer; Hormone-refractory prostate cancer; Kaposi's sarcoma | [5] | |
Marimastat | Drug Info | Discontinued in Phase 3 | Pancreatic cancer; Lung cancer | [3], [6] | |
Prinomastat | Drug Info | Discontinued in Phase 3 | Brain cancer | [1], [2] | |
BB-3644 | Drug Info | Terminated | Cancer | [7] | |
SC-44463 | Drug Info | Terminated | Discovery agent | [8] | |
Inhibitor | 3-Benzenesulfonyl-heptanoic acid hydroxyamide | Drug Info | [9] | ||
3-Cyclohexanesulfonyl-heptanoic acid hydroxyamide | Drug Info | [9] | |||
BB-3644 | Drug Info | [10], [7] | |||
BMS 275291 | Drug Info | [10], [11], [12], [5] | |||
Folate gamma-hydroxamic acid | Drug Info | [13] | |||
Folate gamma-L-phenylalaninehydroxamic acid | Drug Info | [13] | |||
Folate gamma-L-proline-hydroxamic acid | Drug Info | [13] | |||
IK-682 | Drug Info | [14] | |||
Marimastat | Drug Info | [10], [15], [16], [17] | |||
MMI270 | Drug Info | [13] | |||
N-hydroxy-2,3-bis(phenylsulfonamido)propanamide | Drug Info | [18] | |||
Prinomastat | Drug Info | [10], [19], [20], [21], [22] | |||
RS-39066 | Drug Info | [23] | |||
SC-44463 | Drug Info | [24] | |||
SL422 | Drug Info | [25] | |||
SR-973 | Drug Info | [26] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Wnt signaling pathway | ||||
NetPath Pathway | Wnt Signaling Pathway | ||||
PANTHER Pathway | Alzheimer disease-presenilin pathway | ||||
Wnt signaling pathway | |||||
CCKR signaling map ST | |||||
Pathway Interaction Database | Posttranslational regulation of adherens junction stability and dissassembly | ||||
p75(NTR)-mediated signaling | |||||
Syndecan-1-mediated signaling events | |||||
Reactome | Collagen degradation | ||||
Degradation of the extracellular matrix | |||||
Activation of Matrix Metalloproteinases | |||||
Assembly of collagen fibrils and other multimeric structures | |||||
WikiPathways | Wnt Signaling Pathway and Pluripotency | ||||
Activation of Matrix Metalloproteinases | |||||
AGE/RAGE pathway | |||||
Matrix Metalloproteinases | |||||
References | |||||
REF 1 | Emerging therapies for neuropathic pain. Expert Opin Emerg Drugs. 2005 Feb;10(1):95-108. | ||||
REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6505). | ||||
REF 3 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5220). | ||||
REF 4 | Randomized phase III trial of marimastat versus placebo in patients with metastatic breast cancer who have responding or stable disease after first-line chemotherapy: Eastern Cooperative Oncology Group trial E2196. J Clin Oncol. 2004 Dec 1;22(23):4683-90. | ||||
REF 5 | Phase 1/2 trial of BMS-275291 in patients with human immunodeficiency virus-related Kaposi sarcoma: a multicenter trial of the AIDS Malignancy Consortium. Cancer. 2008 Mar 1;112(5):1083-8. | ||||
REF 6 | Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91. | ||||
REF 7 | A phase I and pharmacological study of the matrix metalloproteinase inhibitor BB-3644 in patients with solid tumours. Br J Cancer. 2004 Feb 23;90(4):800-4. | ||||
REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007717) | ||||
REF 9 | J Med Chem. 2000 Jun 15;43(12):2324-31.Hydroxamic acid derivatives as potent peptide deformylase inhibitors and antibacterial agents. | ||||
REF 10 | Tumour microenvironment - opinion: validating matrix metalloproteinases as drug targets and anti-targets for cancer therapy. Nat Rev Cancer. 2006 Mar;6(3):227-39. | ||||
REF 11 | Randomized phase II feasibility study of combining the matrix metalloproteinase inhibitor BMS-275291 with paclitaxel plus carboplatin in advanced non-small cell lung cancer. Lung Cancer. 2004 Dec;46(3):361-8. | ||||
REF 12 | Randomized phase III study of matrix metalloproteinase inhibitor BMS-275291 in combination with paclitaxel and carboplatin in advanced non-small-cell lung cancer: National Cancer Institute of Canada-Clinical Trials Group Study BR.18. J Clin Oncol. 2005 Apr 20;23(12):2831-9. | ||||
REF 13 | Bioorg Med Chem. 2007 Feb 1;15(3):1266-74. Epub 2006 Nov 14.Methotrexate gamma-hydroxamate derivatives as potential dual target antitumor drugs. | ||||
REF 14 | J Med Chem. 2002 Nov 7;45(23):4954-7.Discovery of gamma-lactam hydroxamic acids as selective inhibitors of tumor necrosis factor alpha converting enzyme: design, synthesis, and structure-activity relationships. | ||||
REF 15 | Metalloelastase (MMP-12) induced inflammatory response in mice airways: effects of dexamethasone, rolipram and marimastat. Eur J Pharmacol. 2007 Mar 15;559(1):75-81. Epub 2006 Dec 12. | ||||
REF 16 | Matrix metalloproteinase-2 involvement in breast cancer progression: a mini-review. Med Sci Monit. 2009 Feb;15(2):RA32-40. | ||||
REF 17 | Matrix metalloproteinase inhibition as a novel anticancer strategy: a review with special focus on batimastat and marimastat. Pharmacol Ther. 1997;75(1):69-75. | ||||
REF 18 | Bioorg Med Chem Lett. 2008 Jun 1;18(11):3333-7. Epub 2008 Apr 16.Novel bis-(arylsulfonamide) hydroxamate-based selective MMP inhibitors. | ||||
REF 19 | AG-3340 (Agouron Pharmaceuticals Inc). IDrugs. 2000 Mar;3(3):336-45. | ||||
REF 20 | Pharmacoproteomics of a metalloproteinase hydroxamate inhibitor in breast cancer cells: dynamics of membrane type 1 matrix metalloproteinase-mediated membrane protein shedding. Mol Cell Biol. 2008 Aug;28(15):4896-914. Epub 2008 May 27. | ||||
REF 21 | Delayed administration of a matrix metalloproteinase inhibitor limits progressive brain injury after hypoxia-ischemia in the neonatal rat. J Neuroinflammation. 2008 Aug 11;5:34. | ||||
REF 22 | Inhibition of gelatinase activity reduces neural injury in an ex vivo model of hypoxia-ischemia. Neuroscience. 2009 Jun 2;160(4):755-66. Epub 2009 Mar 9. | ||||
REF 23 | Design, synthesis, activity, and structure of a novel class of matrix metalloproteinase inhibitors containing a heterocyclic P2??P3?? Bioorg. Med. Chem. Lett. 6(13):1541-1542 (1996). | ||||
REF 24 | J Med Chem. 2003 Jul 31;46(16):3514-25.A potent, selective inhibitor of matrix metalloproteinase-3 for the topical treatment of chronic dermal ulcers. | ||||
REF 25 | Design, synthesis, and structure-activity relationships of macrocyclic hydroxamic acids that inhibit tumor necrosis factor alpha release in vitro and in vivo. J Med Chem. 2001 Aug 2;44(16):2636-60. | ||||
REF 26 | Bioorg Med Chem Lett. 2006 May 1;16(9):2357-63. Epub 2006 Feb 10.Synthesis and evaluation of succinoyl-caprolactam gamma-secretase inhibitors. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.