Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T73215
|
||||
Former ID |
TTDS00268
|
||||
Target Name |
B-lymphocyte antigen CD20
|
||||
Gene Name |
MS4A1
|
||||
Synonyms |
B-lymphocyte surface antigen B1; Bp35; CD20; Leu-16; MS4A1
|
||||
Target Type |
Successful
|
||||
Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | |||||
B-cell lymphoma [ICD9: 202.8; ICD10: C85.1] | |||||
Cluster headache [ICD10: G44.0] | |||||
Chronic lymphocytic leukaemia; Non-hodgkin's lymphoma; Systemic lupus erythematosus [ICD9:710; ICD10: C91, C85, M32] | |||||
Chronic lymphocytic leukaemia [ICD10: C91] | |||||
Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
Diffuse large B-cell lymphoma; Multiple sclerosis [ICD9: 202.8, 340; ICD10: C85.1, G35] | |||||
Hematologic malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
Late-stage follicular lymphoma [ICD9: 202.0, 202.8; ICD10: C81-C86, C82] | |||||
Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
Lymphoma; Non-hodgkin's lymphoma [ICD9: 200, 202, 202.8; ICD10: C81-C86, C82-C85] | |||||
Multiple scierosis; Rheumatoid arthritis [ICD9:340, 710-719, 714; ICD10: G35, M05-M06] | |||||
Mantle cell lymphoma [ICD9: 200.4, 202.8, 203.0, 208.9; ICD10: C81-C86, C85.7, C90.0, C91-C95] | |||||
Multiple scierosis [ICD9: 340; ICD10: G35] | |||||
Multiple sclerosis; Primary progressive [ICD9: 340; ICD10: G35] | |||||
Non-hodgkin's lymphoma [ICD10: C85] | |||||
Non-hodgkin's lymphoma; Follicular lymphoma [ICD9: 200, 202, 202.0, 202.8; ICD10: C81-C86, C82, C82-C85] | |||||
Pemphigus disease [ICD9: 694.4; ICD10: L10] | |||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Relapsing or primary progressive forms of multiple sclerosis [ICD10: G35] | |||||
Rheumatold arthritis; Follicular lymphoma [ICD9: 202.0, 714; ICD10: C82, M05-M06] | |||||
Unspecified [ICD code not available] | |||||
Function |
This protein may be involved in the regulation of B-cell activation and proliferation.
|
||||
BioChemical Class |
CD20 ca(2+) channel
|
||||
Target Validation |
T73215
|
||||
UniProt ID | |||||
Sequence |
MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNG
LFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMN SLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPST QYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTI EIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP |
||||
Drugs and Mode of Action | |||||
Drug(s) | Ibritumomab | Drug Info | Approved | Non-hodgkin's lymphoma | [1] |
Obinutuzumab | Drug Info | Approved | Chronic lymphocytic leukaemia | [2], [3] | |
Ocrelizumab | Drug Info | Approved | Relapsing or primary progressive forms of multiple sclerosis | [4] | |
Ofatumumab | Drug Info | Approved | Chronic lymphocytic leukaemia | [5], [6] | |
Rituxan Hemotalogy/oncology | Drug Info | Approved | Non-hodgkin's lymphoma | [7] | |
Rituximab | Drug Info | Approved | Non-hodgkin's lymphoma | [8], [9] | |
Tositumomab | Drug Info | Approved | Non-hodgkin's lymphoma | [1], [10] | |
Bevacizumab + Rituximab | Drug Info | Phase 3 | Lymphoma; Non-hodgkin's lymphoma | [11] | |
MK-8808 | Drug Info | Phase 3 | Late-stage follicular lymphoma | [12] | |
Ofatumumab | Drug Info | Phase 3 | Diffuse large B-cell lymphoma; Multiple sclerosis | [5], [6] | |
PF-05280586 | Drug Info | Phase 3 | Cluster headache | [13] | |
Rituxan Immunology | Drug Info | Phase 3 | Pemphigus disease | [14] | |
AME-133v | Drug Info | Phase 2 | Non-hodgkin's lymphoma | [15], [16] | |
ATM AVI | Drug Info | Phase 2 | Bacterial infections | [17] | |
Ibritumomab | Drug Info | Phase 2 | Mantle cell lymphoma | [18], [19] | |
Iodine-131-tositumomab | Drug Info | Phase 2 | Discovery agent | [20] | |
Ofatumumab | Drug Info | Phase 2 | Rheumatold arthritis; Follicular lymphoma | [5], [6] | |
SBI-087 | Drug Info | Phase 2 | Multiple scierosis; Rheumatoid arthritis | [21] | |
TRU-015 | Drug Info | Phase 2 | Lymphoma | [22] | |
Ublituximab | Drug Info | Phase 2 | Chronic lymphocytic leukaemia | [23] | |
Veltuzumab | Drug Info | Phase 2 | Chronic lymphocytic leukaemia; Non-hodgkin's lymphoma; Systemic lupus erythematosus | [24], [25] | |
DI-Leu16-IL2 | Drug Info | Phase 1/2 | B-cell lymphoma | [26] | |
FBT-A05 | Drug Info | Phase 1/2 | Chronic lymphocytic leukaemia | [27] | |
BM-ca | Drug Info | Phase 1 | Non-hodgkin's lymphoma | [28] | |
CD20Bi aATC | Drug Info | Phase 1 | Non-hodgkin's lymphoma | [29] | |
Iboctadekin + rituximab | Drug Info | Phase 1 | Non-hodgkin's lymphoma; Follicular lymphoma | [30] | |
MK-8808 | Drug Info | Phase 1 | Rheumatoid arthritis | [12] | |
Rituximab | Drug Info | Phase 1 | Hematologic malignancies | [8], [9] | |
Modulator | 2LM20-4 | Drug Info | [31] | ||
Anti-CD20 engineered toxin bodies | Drug Info | [31] | |||
ATM AVI | Drug Info | [31] | |||
CD20Bi aATC | Drug Info | [29] | |||
DI-Leu16-IL2 | Drug Info | [32] | |||
DXL-625 | Drug Info | [31] | |||
MEDI-552 | Drug Info | ||||
Veltuzumab | Drug Info | [33] | |||
Inhibitor | Anti-CD-20 mab | Drug Info | [31] | ||
SBI-087 | Drug Info | [34] | |||
Agonist | MK-8808 | Drug Info | [35] | ||
Antagonist | PF-05280586 | Drug Info | [36] | ||
TRU-015 | Drug Info | [37] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Hematopoietic cell lineage | ||||
References | |||||
REF 1 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
REF 2 | 2013 FDA drug approvals. Nat Rev Drug Discov. 2014 Feb;13(2):85-9. | ||||
REF 3 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6941). | ||||
REF 4 | Drugs@FDA (Edaravone) | ||||
REF 5 | Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92. | ||||
REF 6 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6778). | ||||
REF 7 | Impact of Rituximab (Rituxan) on the Treatment of B-Cell Non-Hodgkin's Lymphoma. P T. 2010 March; 35(3): 148-157. | ||||
REF 8 | Disease-modifying agents for multiple sclerosis: recent advances and future prospects. Drugs. 2008;68(17):2445-68. doi: 10.2165/0003495-200868170-00004. | ||||
REF 9 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6780). | ||||
REF 10 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6781). | ||||
REF 11 | ClinicalTrials.gov (NCT00486759) A Study of Bevacizumab (Avastin) in Combination With Rituximab (MabThera) and CHOP (Cyclophosphamide, Hydroxydaunorubicin [Doxorubicin], Oncovin [Vincristine], Prednisone) Chemotherapy in Patients With Diffuse Large B-cell Lymphoma. U.S. National Institutes of Health. | ||||
REF 12 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800034367) | ||||
REF 13 | ClinicalTrials.gov (NCT02213263) A Study Of PF-05280586 (Rituximab-Pfizer) Or MabThera (Rituximab-EU) For The First-Line Treatment Of Patients With CD20-Positive, Low Tumor Burden, Follicular Lymphoma (REFLECTIONS B328-06). U.S. National Institutes of Health. | ||||
REF 14 | ClinicalTrials.gov (NCT02383589) A Randomized, Double-Blind Study to Evaluate the Efficacy and Safety of Rituximab Versus MMF in Patients With Pemphigus Vulgaris. U.S. National Institutes of Health. | ||||
REF 15 | ClinicalTrials.gov (NCT00354926) Safety and Efficacy Study of an Anti-CD20 Monoclonal Antibody (AME-133v) to Treat Non-Hodgkin's Lymphoma. U.S. National Institutes of Health. | ||||
REF 16 | J Clin Oncol 30, 2012 (suppl, abstr 8081). | ||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800037513) | ||||
REF 18 | Radiation dosimetry results from a Phase II trial of ibritumomab tiuxetan (Zevalin) radioimmunotherapy for patients with non-Hodgkin's lymphoma and mild thrombocytopenia. Cancer Biother Radiopharm. 2003 Apr;18(2):165-78. | ||||
REF 19 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6777). | ||||
REF 20 | ClinicalTrials.gov (NCT01224821) Dosimetry/Validation Study of 131Iodine-Anti B1 (Murine) Radioimmunotherapy for Chemotherapy Refractory Low Grade B Cell Lymphomas and Low Grade Lymphomas That Have Transformed to Higher Grade Histologies. U.S. National Institutes of Health. | ||||
REF 21 | ClinicalTrials.gov (NCT01008852) Study Evaluating The Efficacy And Safety Of SBI-087 In Seropositive Subjects With Active Rheumatoid Arthritis. U.S. National Institutes of Health. | ||||
REF 22 | ClinicalTrials.gov (NCT00634933) Study Evaluating 2 Dosing Regimens Of TRU-015 In Rheumatoid Arthritis. U.S. National Institutes of Health. | ||||
REF 23 | Clinical pipeline report, company report or official report of TG THERAPEUTICS. | ||||
REF 24 | ClinicalTrials.gov (NCT01390545) VELVET, a Dose Range Finding Trial of Veltuzumab in Subjects With Moderate to Severe Rheumatoid Arthritis. U.S. National Institutes of Health. | ||||
REF 25 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8268). | ||||
REF 26 | ClinicalTrials.gov (NCT01874288) Phase I/II Study of De-immunized DI-Leu16-IL2 Immunocytokine Administered Subcutaneously in Patients With B-cell NHL. U.S. National Institutes of Health. | ||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030721) | ||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033790) | ||||
REF 29 | CD20-Targeted T Cells after Stem Cell Transplantation for High Risk and Refractory Non-Hodgkin's Lymphoma. Biol Blood Marrow Transplant. 2013 June; 19(6): 925-933. | ||||
REF 30 | J Clin Oncol 27:15s, 2009 (suppl, abstr 8566). | ||||
REF 31 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2628). | ||||
REF 32 | National Cancer Institute Drug Dictionary (drug id 599668). | ||||
REF 33 | Veltuzumab, an anti-CD20 mAb for the treatment of non-Hodgkin's lymphoma, chronic lymphocytic leukemia and immune thrombocytopenic purpura. Curr Opin Mol Ther. 2009 Apr;11(2):200-7. | ||||
REF 34 | Translational Mini-Review Series on B Cell-Directed Therapies: Recent advances in B cell-directed biological therapies for autoimmune disorders. Clin Exp Immunol. 2009 August; 157(2): 198-208. | ||||
REF 35 | Rituximab (monoclonal anti-CD20 antibody): mechanisms of action and resistance. Oncogene. 2003 Oct 20;22(47):7359-68. | ||||
REF 36 | Comparative nonclinical assessments of the proposed biosimilar PF-05280586 and rituximab (MabThera?). Toxicol Pathol. 2014 Oct;42(7):1069-81. | ||||
REF 37 | TRU-015, a small modular immunopharmaceutical (SMIP?? drug candidate directed against CD20, demonstrates clinical improvement in subjects with rheumatoid arthritis. Arthritis Res Ther. 2007; 9(Suppl 3): P32. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.