Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T46365
|
||||
Former ID |
TTDR00116
|
||||
Target Name |
M-phase inducer phosphatase 2
|
||||
Gene Name |
CDC25B
|
||||
Synonyms |
Cdc25B phosphatase; Dual specificity phosphatase Cdc25B; CDC25B
|
||||
Target Type |
Discontinued
|
||||
Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
Function |
Functionsas a dosage-dependent inducer in mitotic control. It is a tyrosine protein phosphatase required for progression of the cell cycle. It directly dephosphorylates cdc2 and activate its kinase activity.
|
||||
BioChemical Class |
Phosphoric monoester hydrolases
|
||||
Target Validation |
T46365
|
||||
UniProt ID | |||||
EC Number |
EC 3.1.3.48
|
||||
Sequence |
MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
DLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMD PHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEA GSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQ QEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQ DYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ |
||||
Drugs and Mode of Action | |||||
Drug(s) | MX-7065 | Drug Info | Terminated | Cancer | [1] |
Inhibitor | 3-isopropyl-4-(phenylamino)naphthalene-1,2-dione | Drug Info | [2] | ||
3-isopropyl-4-(phenylthio)naphthalene-1,2-dione | Drug Info | [2] | |||
3-isopropyl-4-phenylnaphthalene-1,2-dione | Drug Info | [2] | |||
4-(p-toluidino)-3-isopropylnaphthalene-1,2-dione | Drug Info | [2] | |||
4-ethoxynaphthalene-1,2-dione | Drug Info | [3] | |||
5,6,7,8-tetrahydroanthracene-1,4-dione | Drug Info | [3] | |||
6,7-dibromoquinoline-5,8-dione | Drug Info | [4] | |||
ADOCIAQUINONE B | Drug Info | [4] | |||
ANTHRAQUINONE | Drug Info | [3] | |||
Beta-Mercaptoethanol | Drug Info | [5] | |||
Cysteine Sulfenic Acid | Drug Info | [6] | |||
Cysteinesulfonic Acid | Drug Info | [5] | |||
Double Oxidized Cysteine | Drug Info | [5] | |||
JUGLONE | Drug Info | [3] | |||
Methyl Mercury Ion | Drug Info | [5] | |||
MX-7065 | Drug Info | [7] | |||
NSC-95397 | Drug Info | [4] | |||
Pathways | |||||
KEGG Pathway | MAPK signaling pathway | ||||
Cell cycle | |||||
Progesterone-mediated oocyte maturation | |||||
MicroRNAs in cancer | |||||
NetPath Pathway | IL2 Signaling Pathway | ||||
TGF_beta_Receptor Signaling Pathway | |||||
Wnt Signaling Pathway | |||||
Pathway Interaction Database | PLK1 signaling events | ||||
FOXM1 transcription factor network | |||||
p38 signaling mediated by MAPKAP kinases | |||||
Aurora A signaling | |||||
Reactome | Cyclin B2 mediated events | ||||
Cyclin A/B1 associated events during G2/M transition | |||||
Cdk2-associated events at S phase entry | |||||
WikiPathways | Senescence and Autophagy in Cancer | ||||
MAPK Signaling Pathway | |||||
Retinoblastoma (RB) in Cancer | |||||
Prostate Cancer | |||||
Integrated Breast Cancer Pathway | |||||
Integrated Cancer pathway | |||||
Mitotic G2-G2/M phases | |||||
Cell Cycle | |||||
References | |||||
REF 1 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016615) | ||||
REF 2 | Bioorg Med Chem Lett. 2006 Apr 1;16(7):1905-8. Epub 2006 Jan 24.Synthesis of miltirone analogues as inhibitors of Cdc25 phosphatases. | ||||
REF 3 | Bioorg Med Chem. 2009 Mar 15;17(6):2276-81. Epub 2008 Nov 8.Bioactivities of simplified adociaquinone B and naphthoquinone derivatives against Cdc25B, MKP-1, and MKP-3 phosphatases. | ||||
REF 4 | Bioorg Med Chem. 2008 Oct 1;16(19):9040-9. Epub 2008 Aug 7.Novel naphthoquinone and quinolinedione inhibitors of CDC25 phosphatase activity with antiproliferative properties. | ||||
REF 5 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 6 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January | ||||
REF 7 | Handbook of Assay Development in Drug Discovery, Lisa K. Minor, 2013. Page(11). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.