Target Information

Target General Infomation
Target ID
T77664
Former ID
TTDC00096
Target Name
Interferon gamma
Gene Name
IFNG
Synonyms
IFN-gamma; Immune interferon; IFNG
Target Type
Clinical Trial
Disease B-cell lymphoma [ICD9: 202.8; ICD10: C85.1]
Basal cell cancer [ICD9: 140-229, 173; ICD10: C44]
Discoid lupus erythematosus; Systemic lupus erythematosus [ICD9:695.4, 710; ICD10: L93.0, M32]
Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26]
Inflammatory bowel disease; Rheumatoid arthritis [ICD9: 555, 556, 710-719, 714; ICD10: K50, K51, M00-M25, M05-M06]
Psoriatic disorder [ICD9: 696; ICD10: L40]
Pustular palmoplantar psoriasis; Multiple sclerosis [ICD9: 340, 696, 696.1; ICD10: G35, L40, L40.3]
Prostate cancer [ICD9: 185; ICD10: C61]
Function
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
BioChemical Class
Cytokine: interferon
Target Validation
T77664
UniProt ID
P01579
Sequence
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Drugs and Mode of Action
Drug(s) Fumaric acid Drug Info Phase 3 Pustular palmoplantar psoriasis; Multiple sclerosis [536837]
VIR-201 Drug Info Phase 1/2 Human immunodeficiency virus infection [546793]
AMG 811 Drug Info Phase 1 Discoid lupus erythematosus; Systemic lupus erythematosus [548727]
CIGB-128 Drug Info Phase 1 Basal cell cancer [549462]
VPM-4-001 Drug Info Preclinical Prostate cancer [548240]
CRx-191 Drug Info Discontinued in Phase 2 Psoriatic disorder [548453]
Fontolizumab Drug Info Discontinued in Phase 2 Inflammatory bowel disease; Rheumatoid arthritis [536651]
TG-1042 Drug Info Discontinued in Phase 2 B-cell lymphoma [546783]
Modulator AMG 811 Drug Info [532955]
CIGB-128 Drug Info
TG-1042 Drug Info [528943]
VIR-201 Drug Info [550833]
Inhibitor CRx-191 Drug Info [551126]
Binder Fumaric acid Drug Info [536837]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
Pathways
KEGG Pathway Proteasome
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
Regulation of autophagy
TGF-beta signaling pathway
Osteoclast differentiation
Antigen processing and presentation
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Type I diabetes mellitus
Salmonella infection
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
NetPath Pathway IL1 Signaling Pathway
TCR Signaling Pathway
IL2 Signaling Pathway
Leptin Signaling Pathway
PANTHER Pathway Inflammation mediated by chemokine and cytokine signaling pathway
Interferon-gamma signaling pathway
Pathway Interaction Database IL27-mediated signaling events
IL12-mediated signaling events
Calcineurin-regulated NFAT-dependent transcription in lymphocytes
SHP2 signaling
Regulation of Telomerase
Glucocorticoid receptor regulatory network
IL2-mediated signaling events
IFN-gamma pathway
ATF-2 transcription factor network
AP-1 transcription factor network
IL23-mediated signaling events
PDGFR-alpha signaling pathway
Calcium signaling in the CD4+ TCR pathway
Downstream signaling in na&amp
#xef
ve CD8+ T cells
IL12 signaling mediated by STAT4
Reactome Interferon gamma signaling
Regulation of IFNG signaling
WikiPathways Type II interferon signaling (IFNG)
Senescence and Autophagy in Cancer
TGF Beta Signaling Pathway
Cytokines and Inflammatory Response
Hypertrophy Model
Inflammatory Response Pathway
Aryl Hydrocarbon Receptor Pathway
IL1 and megakaryotyces in obesity
Cytodifferentiation (Part 3 of 3)
Spinal Cord Injury
Allograft Rejection
Interferon gamma signaling
Proteasome Degradation
Folate Metabolism
Vitamin B12 Metabolism
Selenium Micronutrient Network
References
Ref 536651Emerging drugs for rheumatoid arthritis. Expert Opin Emerg Drugs. 2008 Mar;13(1):175-96.
Ref 536837Emerging oral drugs for multiple sclerosis. Expert Opin Emerg Drugs. 2008 Sep;13(3):465-77.
Ref 546783Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010265)
Ref 546793Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010310)
Ref 548240Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023655)
Ref 548453Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025635)
Ref 548727Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028077)
Ref 549462Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800037683)
Ref 528943Drug evaluation: TG-1042, an adenovirus-mediated IFNgamma gene delivery for the intratumoral therapy of primary cutaneous lymphomas. Curr Opin Investig Drugs. 2007 Jun;8(6):493-8.
Ref 530762BioPartnering North America--Programs from Pharma in Europe and the Middle East. IDrugs. 2010 Mar;13(3):162-5.
Ref 532955Pharmacokinetic and pharmacodynamic relationship of AMG 811, an anti-IFN-gamma IgG1 monoclonal antibody, in patients with systemic lupus erythematosus. Pharm Res. 2015 Feb;32(2):640-53.
Ref 536371Emerging drugs to treat Crohn's disease. Expert Opin Emerg Drugs. 2007 Mar;12(1):49-59.
Ref 536837Emerging oral drugs for multiple sclerosis. Expert Opin Emerg Drugs. 2008 Sep;13(3):465-77.
Ref 550833EP patent application no. 17782511, Nucleoside phosphonate conjugates as anti hiv agents.
Ref 551126CombinatoRx Drug Candidate CRx-191 Demonstrates Positive Phase 2 Results In Psoriasis. CombinatoRx. 2008.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.