Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T59045
|
||||
Former ID |
TTDS00024
|
||||
Target Name |
4-aminobutyrate aminotransferase, mitochondrial
|
||||
Gene Name |
ABAT
|
||||
Synonyms |
(S)-3-amino-2-methylpropionate transaminase; GABA aminotransferase; GABA transaminase; GABA-AT; GABA-T; Gamma-amino-N-butyrate transaminase; L-AIBAT; ABAT
|
||||
Target Type |
Successful
|
||||
Disease | Dietary shortage; Glioma [ICD9:260-269, 191; ICD10: E40-E46, C71] | ||||
Dementia [ICD9: 290-294; ICD10: F01-F07] | |||||
Dietary shortage [ICD9: 260-269; ICD10: E40-E46] | |||||
Epilepsy; Infantile spasms; Complex partial seizures [ICD9: 345, 345.4, 345.5, 345.9, 728.85, 780.3; ICD10: G40, G40.2, P90, R25.2, R56] | |||||
Infantile spasms [ICD10: G40.4] | |||||
Seizures [ICD9: 345.9, 780.3; ICD10: G40, P90, R56] | |||||
Substance dependence [ICD10: F10-F19] | |||||
Function |
Catalyzes the conversion of gamma-aminobutyrate and L- beta-aminoisobutyrate to succinate semialdehyde and methylmalonate semialdehyde, respectively. Can also convert delta-aminovalerate andbeta-alanine.
|
||||
BioChemical Class |
Transferases of nitrogenous groups
|
||||
Target Validation |
T59045
|
||||
UniProt ID | |||||
EC Number |
EC 2.6.1.22
|
||||
Sequence |
MASMLLAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSQELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQ NASMFVNRPALGILPPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENALKTIFMWYR SKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL DLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF RDHHAHLFLNIFSDILADFK |
||||
Drugs and Mode of Action | |||||
Drug(s) | Divalproex sodium | Drug Info | Approved | Seizures | [1] |
L-Alanine | Drug Info | Approved | Dietary shortage; Glioma | [2], [3], [4] | |
Pyridoxal Phosphate | Drug Info | Approved | Dietary shortage | [5], [6] | |
Pyruvic acid | Drug Info | Approved | Dietary shortage | [7], [8] | |
Vigabatrin | Drug Info | Approved | Epilepsy; Infantile spasms; Complex partial seizures | [9], [10] | |
K-828-AB | Drug Info | Phase 2 | Dementia | [11] | |
CPP -15 | Drug Info | Phase 1 | Infantile spasms | [12] | |
CPP-115 | Drug Info | Phase 1 | Substance dependence | [13], [14] | |
Inhibitor | (4e)-4-Aminohex-4-Enoic Acid | Drug Info | [15] | ||
1-(4-hydroxyphenyl)prop-2-en-1-one | Drug Info | [16] | |||
3-chloro-1-(4-hydroxyphenyl)propan-1-one | Drug Info | [17] | |||
4-Amino Hexanoic Acid | Drug Info | [15] | |||
4-hydroxy-3-nitrobenzaldehyde | Drug Info | [16] | |||
4-hydroxybenzaldehyde | Drug Info | [17] | |||
4-hydroxybenzylamine | Drug Info | [16] | |||
Acetate Ion | Drug Info | [15] | |||
CPP-115 | Drug Info | [18] | |||
Divalproex sodium | Drug Info | [19] | |||
Gamma-acetylenic GABA | Drug Info | [20] | |||
K-828-AB | Drug Info | [21] | |||
L-Alanine | Drug Info | [19] | |||
NIPECOTIC ACID | Drug Info | [22] | |||
OXAMATE | Drug Info | [22] | |||
Pyridoxal Phosphate | Drug Info | [19] | |||
Pyruvic acid | Drug Info | [19] | |||
Sodium valproate | Drug Info | [23] | |||
VANILLIN | Drug Info | [16] | |||
Vigabatrin | Drug Info | [10], [24], [25], [26] | |||
Modulator | CPP -15 | Drug Info | [18] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | GABA shunt | ||||
Valine degradation | |||||
Beta-alanine degradation | |||||
4-aminobutyrate degradation | |||||
KEGG Pathway | Alanine, aspartate and glutamate metabolism | ||||
Valine, leucine and isoleucine degradation | |||||
beta-Alanine metabolism | |||||
Propanoate metabolism | |||||
Butanoate metabolism | |||||
Metabolic pathways | |||||
GABAergic synapse | |||||
PANTHER Pathway | Aminobutyrate degradation | ||||
Pyrimidine Metabolism | |||||
Gamma-aminobutyric acid synthesis | |||||
PathWhiz Pathway | Aspartate Metabolism | ||||
Glutamate Metabolism | |||||
Beta-Alanine Metabolism | |||||
Valine, Leucine and Isoleucine Degradation | |||||
Propanoate Metabolism | |||||
WikiPathways | GABA synthesis, release, reuptake and degradation | ||||
Alanine and aspartate metabolism | |||||
References | |||||
REF 1 | FDA approved drugs (1996) in CenterWatch | ||||
REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 720). | ||||
REF 3 | Drug information of L-Alanine, Health Canada, 2008. (drugid: 7638) | ||||
REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 5 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5249). | ||||
REF 6 | Drug information of Pyridoxal Phosphate, 2008. eduDrugs. | ||||
REF 7 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4809). | ||||
REF 8 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 065200. | ||||
REF 9 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4821). | ||||
REF 10 | Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92. | ||||
REF 11 | Clinical pipeline report, company report or official report of Kowa Co Ltd. | ||||
REF 12 | Clinical pipeline report, company report or official report of Catalyst Pharma. | ||||
REF 13 | ClinicalTrials.gov (NCT01493596) A Safety, Tolerability and Pharmacokinetic Study of CPP-115. U.S. National Institutes of Health. | ||||
REF 14 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8284). | ||||
REF 15 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 16 | Bioorg Med Chem Lett. 2006 Feb;16(3):592-5. Epub 2005 Nov 14.Inhibition of GABA shunt enzymes' activity by 4-hydroxybenzaldehyde derivatives. | ||||
REF 17 | Bioorg Med Chem Lett. 2009 Feb 1;19(3):731-4. Epub 2008 Dec 11.Inactivation of GABA transaminase by 3-chloro-1-(4-hydroxyphenyl)propan-1-one. | ||||
REF 18 | Clinical pipeline report, company report or official report of Catalyst Pharma. | ||||
REF 19 | DrugBank: a knowledgebase for drugs, drug actions and drug targets. Nucleic Acids Res. 2008 Jan;36(Database issue):D901-6. Epub 2007 Nov 29. | ||||
REF 20 | Treatment of Huntington disease with gamma-acetylenic GABA an irreversible inhibitor of GABA-transaminase: increased CSF GABA and homocarnosine without clinical amelioration. Neurology. 1981 Feb;31(2):207-11. | ||||
REF 21 | Phase II clinical trial of K-828-AB for treating behavioral and psychological symptoms of dementia. Kowa Co. Ltd. | ||||
REF 22 | J Med Chem. 1982 Feb;25(2):113-6.Aminomethyl-1,2,4-benzothiadiazines as potential analogues of gamma-aminobutyric acid. Unexpected discovery of a taurine antagonist. | ||||
REF 23 | Influence of a GABA transaminase inhibitor on central nervous system oxygen toxicity. Aviat Space Environ Med. 1978 Jul;49(7):877-9. | ||||
REF 24 | Gamma-vinyl GABA, an irreversible inhibitor of GABA transaminase, alters the acquisition and expression of cocaine-induced sensitization in male rats. Synapse. 2002 Dec 15;46(4):240-50. | ||||
REF 25 | Glutamate- and GABA-based CNS therapeutics. Curr Opin Pharmacol. 2006 Feb;6(1):7-17. | ||||
REF 26 | Vigabatrin for refractory complex partial seizures: multicenter single-blind study with long-term follow-up. Neurology. 1987 Feb;37(2):184-9. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.