Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T77195
|
||||
| Former ID |
TTDS00469
|
||||
| Target Name |
NADH dehydrogenase
|
||||
| Gene Name |
MT-ND3
|
||||
| Synonyms |
MT-ND; MTND; NADH; NADH-ubiquinone oxidoreductase; ND; MT-ND3
|
||||
| Target Type |
Successful
|
||||
| Disease | Parkinson's disease [ICD9: 332; ICD10: G20] | ||||
| Function |
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in thetransfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
|
||||
| BioChemical Class |
Oxidoreductases acting on NADH or NADPH
|
||||
| Target Validation |
T77195
|
||||
| UniProt ID | |||||
| EC Number |
EC 1.6.5.3
|
||||
| Sequence |
MNFALILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPMSPARVPFSMKFFLVAI
TFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSLAYEWLQKGLDWTE |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | NADH | Drug Info | Approved | Parkinson's disease | [1], [2] |
| Inhibitor | 6-Thiophen-2-yl-imidazo[2,1-b]thiazole | Drug Info | [3] | ||
| 6-Thiophen-3-yl-imidazo[2,1-b]thiazole | Drug Info | [3] | |||
| N-Formylmethionine | Drug Info | [4] | |||
| Binder | NADH | Drug Info | [5] | ||
| Pathways | |||||
| KEGG Pathway | Oxidative phosphorylation | ||||
| Metabolic pathways | |||||
| Parkinson' | |||||
| s disease | |||||
| WikiPathways | Oxidative phosphorylation | ||||
| Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. | |||||
| Electron Transport Chain | |||||
| References | |||||
| REF 1 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4487). | ||||
| REF 2 | Drug information of NADH, 2008. eduDrugs. | ||||
| REF 3 | J Med Chem. 1995 Mar 31;38(7):1090-7.Thienylimidazo[2,1-b]thiazoles as inhibitors of mitochondrial NADH dehydrogenase. | ||||
| REF 4 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 5 | Mechanism of cadmium-decreased glucuronidation in the rat. Biochem Pharmacol. 1992 Dec 1;44(11):2139-47. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.