Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T67801
|
||||
| Former ID |
TTDR01148
|
||||
| Target Name |
Lactotransferrin
|
||||
| Gene Name |
LTF
|
||||
| Synonyms |
Lactoferrin; LTF
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
| Diabetic foot ulcer [ICD9: 707; ICD10: L88-L89] | |||||
| Function |
Transferrins are iron binding transport proteins which can bind two atoms of ferric iron in association with the binding of an anion, usually bicarbonate.lactoferroxins a, b and c have opioid antagonist activity. Lactoferroxin a shows preference for mu-receptor.
|
||||
| BioChemical Class |
Peptidase
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.21.-
|
||||
| Sequence |
MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDS
PIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKG GSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGA DKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDE AERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKD KSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAAR RARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYT AGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHT AVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNS NERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRK PVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNL LFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Parecoxib | Drug Info | Phase 4 | Discovery agent | [1], [2] |
| Talactoferrin | Drug Info | Phase 3 | Diabetic foot ulcer | [3] | |
| HLF 1-11 | Drug Info | Phase 1/2 | Bacterial infections | [4] | |
| Nimesulide | Drug Info | Withdrawn from market | Discovery agent | [5], [6] | |
| Inhibitor | 3h-Indole-5,6-Diol | Drug Info | [7] | ||
| Alpha-D-Fucose | Drug Info | [7] | |||
| Alpha-D-Mannose | Drug Info | [7] | |||
| Fucose | Drug Info | [7] | |||
| Lauric Acid | Drug Info | [7] | |||
| Nimesulide | Drug Info | [8] | |||
| Nitrilotriacetic Acid | Drug Info | [7] | |||
| Parecoxib | Drug Info | [9] | |||
| Modulator | HLF 1-11 | Drug Info | [10] | ||
| Talactoferrin | Drug Info | [11] | |||
| Pathways | |||||
| NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
| TCR Signaling Pathway | |||||
| Reactome | ROS production in response to bacteria | ||||
| Amyloid formation | |||||
| WikiPathways | Latent infection of Homo sapiens with Mycobacterium tuberculosis | ||||
| References | |||||
| REF 1 | ClinicalTrials.gov (NCT00455117) Effect of Parecoxib on Post-craniotomy Pain. U.S. National Institutes of Health. | ||||
| REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2895). | ||||
| REF 3 | ClinicalTrials.gov (NCT00706862) Safety and Efficacy of Talactoferrin in Addition to Standard Chemotherapy in Patients With Non-small Cell Lung Cancer. U.S. National Institutes of Health. | ||||
| REF 4 | ClinicalTrials.gov (NCT00509847) A Study on the Tolerability and Early Efficacy of hLF1-11 in Patients With Bacteremia Due to S. Epidermidis. U.S. National Institutes of Health. | ||||
| REF 5 | ClinicalTrials.gov (NCT01257126) Efficacy of Diclofenac Potassium vs Nimesulide in the Treatment of Fever and Pain in Children With Upper Respiratory Tract Infection. U.S. National Institutes of Health. | ||||
| REF 6 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7401). | ||||
| REF 7 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 8 | Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. | ||||
| REF 9 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
| REF 10 | The synthetic N-terminal peptide of human lactoferrin, hLF(1-11), is highly effective against experimental infection caused by multidrug-resistant Acinetobacter baumannii. Antimicrob Agents Chemother. 2004 Dec;48(12):4919-21. | ||||
| REF 11 | Talactoferrin alfa, a recombinant human lactoferrin promotes healing of diabetic neuropathic ulcers: a phase 1/2 clinical study. Am J Surg. 2007 Jan;193(1):49-54. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.