Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T67102
|
||||
Former ID |
TTDR00447
|
||||
Target Name |
Cathepsin D
|
||||
Gene Name |
CTSD
|
||||
Synonyms |
CD; CTSD
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Hypertension [ICD9: 401; ICD10: I10-I16] | ||||
Multiple scierosis [ICD9: 340; ICD10: G35] | |||||
Function |
Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.
|
||||
BioChemical Class |
Peptidase
|
||||
Target Validation |
T67102
|
||||
UniProt ID | |||||
EC Number |
EC 3.4.23.5
|
||||
Sequence |
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL |
||||
Drugs and Mode of Action | |||||
Inhibitor | 1h-Benoximidazole-2-Carboxylic Acid | Drug Info | [551393] | ||
Alpha-D-Mannose | Drug Info | [551393] | |||
Carbocyclic Peptidomimetic | Drug Info | [527675] | |||
CI-992 | Drug Info | [527925] | |||
compound 1 | Drug Info | [525597] | |||
compound 3 | Drug Info | [534030] | |||
GRASSYSTATIN A | Drug Info | [530345] | |||
GRL-7234 | Drug Info | [528786] | |||
KNI-10006 | Drug Info | [530280] | |||
N-Aminoethylmorpholine | Drug Info | [551393] | |||
S-Methylcysteine | Drug Info | [551393] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
BioCyc Pathway | Thyroid hormone biosynthesis | ||||
KEGG Pathway | Sphingolipid signaling pathway | ||||
Lysosome | |||||
Tuberculosis | |||||
NetPath Pathway | IL2 Signaling Pathway | ||||
Pathway Interaction Database | LKB1 signaling events | ||||
Ceramide signaling pathway | |||||
Direct p53 effectors | |||||
Validated nuclear estrogen receptor alpha network | |||||
Reactome | Collagen degradation | ||||
Metabolism of Angiotensinogen to Angiotensins | |||||
MHC class II antigen presentation | |||||
References | |||||
Ref 525597 | Synthesis and structure activity relationships of novel small molecule cathepsin D inhibitors. Bioorg Med Chem Lett. 1999 Sep 6;9(17):2531-6. | ||||
Ref 525597 | Synthesis and structure activity relationships of novel small molecule cathepsin D inhibitors. Bioorg Med Chem Lett. 1999 Sep 6;9(17):2531-6. | ||||
Ref 527675 | J Med Chem. 2005 Aug 11;48(16):5175-90.Structure-based design, synthesis, and memapsin 2 (BACE) inhibitory activity of carbocyclic and heterocyclic peptidomimetics. | ||||
Ref 527925 | J Med Chem. 1992 Jul 10;35(14):2562-72.Structure-activity relationships of a series of 2-amino-4-thiazole-containing renin inhibitors. | ||||
Ref 528786 | J Med Chem. 2007 May 17;50(10):2399-407. Epub 2007 Apr 14.Design, synthesis, and X-ray structure of potent memapsin 2 (beta-secretase) inhibitors with isophthalamide derivatives as the P2-P3-ligands. | ||||
Ref 530280 | Bioorg Med Chem. 2009 Aug 15;17(16):5933-49. Epub 2009 Jul 3.alpha-Substituted norstatines as the transition-state mimic in inhibitors of multiple digestive vacuole malaria aspartic proteases. | ||||
Ref 530345 | J Med Chem. 2009 Sep 24;52(18):5732-47.Grassystatins A-C from marine cyanobacteria, potent cathepsin E inhibitors that reduce antigen presentation. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.