Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T20575
|
||||
Former ID |
TTDR00763
|
||||
Target Name |
C-C chemokine receptor type 8
|
||||
Gene Name |
CCR8
|
||||
Synonyms |
C-C CKR-8; CC-CKR-8; CC-chemokine receptor CHEMR1; CCR-8; CKR-L1; CMKBRL2; Chemokine receptor CCR8; Chemokine receptor-like 1; GPR-CY6; GPRCY6; TER1; CCR8
|
||||
Target Type |
Discontinued
|
||||
Disease | Psoriasis [ICD9: 696; ICD10: L40] | ||||
Function |
Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T20575
|
||||
UniProt ID | |||||
Sequence |
MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVL
VVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSS MFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGV LQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLV LIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL |
||||
Drugs and Mode of Action | |||||
Antagonist | CCX-832 | Drug Info | [544435] | ||
viral macrophage inflammatory protein-II | Drug Info | [525544] | |||
Binder | I-309 | Drug Info | [538110] | ||
Inhibitor | N-(4-phenylsulfamoyl-naphthalen-1-yl)-benzamide | Drug Info | [528647] | ||
N-{4-[(benzylamino)sulfonyl]-1-naphthyl}benzamide | Drug Info | [528647] | |||
Agonist | ZK 756326 | Drug Info | [527803] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
Chemokine signaling pathway | |||||
Viral carcinogenesis | |||||
NetPath Pathway | IL2 Signaling Pathway | ||||
PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
Reactome | Chemokine receptors bind chemokines | ||||
G alpha (i) signalling events | |||||
WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
Peptide GPCRs | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 525544 | HHV8-encoded vMIP-I selectively engages chemokine receptor CCR8. Agonist and antagonist profiles of viral chemokines. J Biol Chem. 1999 Jul 30;274(31):21569-74. | ||||
Ref 527803 | Identification and characterization of a potent, selective nonpeptide agonist of the CC chemokine receptor CCR8. Mol Pharmacol. 2006 Jan;69(1):309-16. Epub 2005 Oct 12. | ||||
Ref 528647 | J Med Chem. 2007 Feb 8;50(3):566-84.Design, synthesis, and evaluation of naphthalene-sulfonamide antagonists of human CCR8. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.