Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T06093
|
||||
Former ID |
TTDI02162
|
||||
Target Name |
Rho associated protein kinase 2
|
||||
Gene Name |
ROCK2
|
||||
Synonyms |
ROCK-II; Rho kinase 2; Rho-associated, coiled-coil-containing protein kinase 2; Rho-associated, coiled-coil-containing protein kinase II; p164 ROCK-2; ROCK2
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Cancer [ICD9: 140-229; ICD10: C00-C96] | ||||
Chronic obstructive pulmonary disease [ICD9: 490-492, 494-496; ICD10: J40-J44, J47] | |||||
Glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
Rheumatoid arthritis [ICD9: 710-719, 714; ICD10: M05-M06] | |||||
Function |
Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of ADD1, BRCA2, CNN1, EZR, DPYSL2, EP300, MSN, MYL9/MLC2, NPM1, RDX, PPP1R12A and VIM. Phosphorylates SORL1 and IRF4. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Positively regulates the activation of p42/MAPK1-p44/MAPK3 and of p90RSK/RPS6KA1 during myogenic differentiation. Plays an important role in the timely initiation of centrosome duplication. Inhibits keratinocyte terminal differentiation. May regulate closure of the eyelids and ventral body wall through organization of actomyosin bundles. Plays a critical role in the regulation of spine and synaptic properties in the hippocampus. Plays an important role in generating the circadian rhythm of the aortic myofilament Ca(2+) sensitivity and vascular contractility by modulating the myosin light chain phosphorylation.
|
||||
BioChemical Class |
Kinase
|
||||
UniProt ID | |||||
EC Number |
EC 2.7.11.1
|
||||
Sequence |
MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNL MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD ETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLV GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWH WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL LLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKT AKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL EDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRICGLEEDLKNGKI LLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNK IYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLK QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQK KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQF EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQ MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG DAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD ISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR QLAPNKPS |
||||
Drugs and Mode of Action | |||||
Inhibitor | AMA-237 | Drug Info | [543434] | ||
ATS-907 | Drug Info | [543434] | |||
CDE-5110 | Drug Info | [548488] | |||
compound 11d | Drug Info | [543434] | |||
compound 22 | Drug Info | [530910] | |||
compound 32 | Drug Info | [530917] | |||
compound 35 | Drug Info | [531084] | |||
Glycyl-H 1152 | Drug Info | [527785] | |||
GSK269962A | Drug Info | [528461] | |||
KD025 | Drug Info | [533023] | |||
RKI-1447 | Drug Info | [532172] | |||
SR-3850 | Drug Info | [543434] | |||
TRN-101 | Drug Info | [543434] | |||
Modulator | INS-117548 | Drug Info | [1572591] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | cGMP-PKG signaling pathway | ||||
cAMP signaling pathway | |||||
Chemokine signaling pathway | |||||
Sphingolipid signaling pathway | |||||
Vascular smooth muscle contraction | |||||
Wnt signaling pathway | |||||
Axon guidance | |||||
Focal adhesion | |||||
Platelet activation | |||||
Leukocyte transendothelial migration | |||||
Regulation of actin cytoskeleton | |||||
Oxytocin signaling pathway | |||||
Pathogenic Escherichia coli infection | |||||
Shigellosis | |||||
Salmonella infection | |||||
Pathways in cancer | |||||
Proteoglycans in cancer | |||||
PANTHER Pathway | Cytoskeletal regulation by Rho GTPase | ||||
Pathway Interaction Database | RhoA signaling pathway | ||||
Plasma membrane estrogen receptor signaling | |||||
Osteopontin-mediated events | |||||
PLK1 signaling events | |||||
PAR4-mediated thrombin signaling events | |||||
PAR1-mediated thrombin signaling events | |||||
Signaling events mediated by focal adhesion kinase | |||||
Reactome | EPHB-mediated forward signaling | ||||
EPHA-mediated growth cone collapse | |||||
G alpha (12/13) signalling events | |||||
Sema4D induced cell migration and growth-cone collapse | |||||
VEGFA-VEGFR2 Pathway | |||||
RHO GTPases Activate ROCKs | |||||
WikiPathways | G13 Signaling Pathway | ||||
Regulation of Actin Cytoskeleton | |||||
Focal Adhesion | |||||
JAK/STAT | |||||
Spinal Cord Injury | |||||
Pathogenic Escherichia coli infection | |||||
Leptin signaling pathway | |||||
Semaphorin interactions | |||||
Integrin-mediated Cell Adhesion | |||||
GPCR downstream signaling | |||||
MicroRNAs in cardiomyocyte hypertrophy | |||||
Androgen receptor signaling pathway | |||||
References | |||||
Ref 522456 | ClinicalTrials.gov (NCT00767793) A Placebo-Controlled Study of INS117548 Ophthalmic Solution in Subjects With Glaucoma (P08650). U.S. National Institutes of Health. | ||||
Ref 525025 | ClinicalTrials.gov (NCT02317627) Study of of KD025 in Subjects With Psoriasis Vulgaris Who Failed First-Line Therapy. U.S. National Institutes of Health. | ||||
Ref 527785 | Development of specific Rho-kinase inhibitors and their clinical application. Biochim Biophys Acta. 2005 Dec 30;1754(1-2):245-52. Epub 2005 Sep 12. | ||||
Ref 528461 | Novel Rho kinase inhibitors with anti-inflammatory and vasodilatory activities. J Pharmacol Exp Ther. 2007 Jan;320(1):89-98. Epub 2006 Oct 3. | ||||
Ref 530910 | Substituted 2H-isoquinolin-1-one as potent Rho-Kinase inhibitors. Part 1: Hit-to-lead account. Bioorg Med Chem Lett. 2010 Jun 1;20(11):3235-9. | ||||
Ref 530917 | Substituted 2H-isoquinolin-1-ones as potent Rho-kinase inhibitors: part 3, aryl substituted pyrrolidines. Bioorg Med Chem Lett. 2010 Jun 15;20(12):3746-9. | ||||
Ref 531084 | Tetrahydroisoquinoline derivatives as highly selective and potent Rho kinase inhibitors. J Med Chem. 2010 Aug 12;53(15):5727-37. | ||||
Ref 532172 | Pyridylthiazole-based ureas as inhibitors of Rho associated protein kinases (ROCK1 and 2). Medchemcomm. 2012 Jun 1;3(6):699-709. Epub 2012 Jan 27. | ||||
Ref 533023 | Selective oral ROCK2 inhibitor down-regulates IL-21 and IL-17 secretion in human T cells via STAT3-dependent mechanism. Proc Natl Acad Sci U S A. 2014 Nov 25;111(47):16814-9. | ||||
Ref 543434 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1504). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.