Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T72171
|
||||
Former ID |
TTDI02236
|
||||
Target Name |
mRNA of CCR5
|
||||
Gene Name |
CCR5
|
||||
Synonyms |
CC CKR5 (mRNA); CC chemokine receptortype 5 (mRNA); CCCKR5 (mRNA); CCR5 (mRNA); CD195 (mRNA); CHEMR13 (mRNA); HIV1 fusion coreceptor (mRNA); CCR5
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | ||||
Function |
Receptor for a numberof inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 R5 isolates. {ECO:0000269|PubMed:11323418, ECO:0000269|PubMed:8639485, ECO:0000269|PubMed:8649511, ECO:0000269|PubMed:8649512, ECO:0000269|PubMed:8663314, ECO:0000269|PubMed:8699119}.
|
||||
BioChemical Class |
ddRNAi
|
||||
UniProt ID | |||||
Sequence |
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL |
||||
Drugs and Mode of Action | |||||
Pathways | |||||
KEGG Pathway | Cytokine-cytokine receptor interaction | ||||
Chemokine signaling pathway | |||||
Endocytosis | |||||
Toxoplasmosis | |||||
Viral carcinogenesis | |||||
NetPath Pathway | TSLP Signaling Pathway | ||||
TCR Signaling Pathway | |||||
IL2 Signaling Pathway | |||||
PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
Pathway Interaction Database | IL12-mediated signaling events | ||||
Reactome | Binding and entry of HIV virion | ||||
Chemokine receptors bind chemokines | |||||
G alpha (i) signalling events | |||||
WikiPathways | TCR Signaling Pathway | ||||
GPCRs, Class A Rhodopsin-like | |||||
HIV Life Cycle | |||||
Peptide GPCRs | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
GPCRs, Other | |||||
References | |||||
Ref 527876 | Molecular cloning and radioligand binding characterization of the chemokine receptor CCR5 from rhesus macaque and human. Biochem Pharmacol. 2005 Dec 19;71(1-2):163-72. Epub 2005 Nov 18. | ||||
Ref 527892 | Discovery and characterization of vicriviroc (SCH 417690), a CCR5 antagonist with potent activity against human immunodeficiency virus type 1. Antimicrob Agents Chemother. 2005 Dec;49(12):4911-9. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.