Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T93995
|
|||||
Target Name |
Ubiquitin-like protein Nedd8 (NEDD8)
|
|||||
Synonyms |
Neural precursor cell expressed developmentally down-regulated protein 8; Neddylin; NEDD-8
Click to Show/Hide
|
|||||
Gene Name |
NEDD8
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Myelodysplastic syndrome [ICD-11: 2A37] | |||||
Function |
Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins.
Click to Show/Hide
|
|||||
BioChemical Class |
Ubiquitin family
|
|||||
UniProt ID | ||||||
Sequence |
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
ILGGSVLHLVLALRGGGGLRQ Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | MLN4924 | Drug Info | Phase 3 | Myelodysplastic syndrome | [2], [3] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 1 Inhibitor drugs | + | ||||
1 | MLN4924 | Drug Info | [1] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: Adenosine triphosphate | Ligand Info | |||||
Structure Description | Structure of APPBP1-UBA3~NEDD8-NEDD8-MgATP-Ubc12(C111A), a trapped ubiquitin-like protein activation complex | PDB:2NVU | ||||
Method | X-ray diffraction | Resolution | 2.80 Å | Mutation | Yes | [4] |
PDB Sequence |
MLIKVKTLTG
10 KEIEIDIEPT20 DKVERIKERV30 EEKEGIPPQQ40 QRLIYSGKQM50 NDEKTAADYK 60 ILGGSVLHLV70 LALRGG
|
|||||
|
||||||
Click to View More Binding Site Information of This Target and Ligand Pair | ||||||
Ligand Name: MLN4924 | Ligand Info | |||||
Structure Description | Structure of NEDD8-activating enzyme in complex with NEDD8 and MLN4924 | PDB:3GZN | ||||
Method | X-ray diffraction | Resolution | 3.00 Å | Mutation | No | [5] |
PDB Sequence |
HHHMLIKVKT
7 LTGKEIEIDI17 EPTDKVERIK27 ERVEEKEGIP37 PQQQRLIYSG47 KQMNDEKTAA 57 DYKILGGSVL67 HLVLALRGG
|
|||||
|
||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Biological Network Descriptors
|
There is no similarity protein (E value < 0.005) for this target
|
Degree | 45 | Degree centrality | 4.83E-03 | Betweenness centrality | 3.47E-03 |
---|---|---|---|---|---|
Closeness centrality | 2.51E-01 | Radiality | 1.44E+01 | Clustering coefficient | 1.86E-01 |
Neighborhood connectivity | 4.03E+01 | Topological coefficient | 4.75E-02 | Eccentricity | 12 |
Download | Click to Download the Full PPI Network of This Target | ||||
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-interacting Proteins |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Promoting tumorigenesis in nasopharyngeal carcinoma, NEDD8 serves as a potential theranostic target.Cell Death Dis. 2017 Jun 1;8(6):e2834. | |||||
REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 3 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 4 | Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity. Nature. 2007 Jan 25;445(7126):394-8. | |||||
REF 5 | Substrate-assisted inhibition of ubiquitin-like protein-activating enzymes: the NEDD8 E1 inhibitor MLN4924 forms a NEDD8-AMP mimetic in situ. Mol Cell. 2010 Jan 15;37(1):102-11. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.