Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T58470 | Target Info | |||
| Target Name | Cyclin A2 (CCNA2) | ||||
| Synonyms | Cyclin-A2; Cyclin-A; Cyclin A; CCNA | ||||
| Target Type | Literature-reported Target | ||||
| Gene Name | CCNA2 | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | E2F-5/p107 (E2F5/RBL1) heterodimer | ||||
| Classification | Superclass | Helix-turn-helix | |||
| Class | Fork head / winged helix | ||||
| Regulation Mechanism | Cell cycle regulation of the cyclin A gene promoter is mediated by a variant E2F site. | [1] | |||
| Evidence Score (E-score) | 2 | + | |||
| 1 | Beta-Galactosidase Assay | [3] | |||
| 2 | Electrophoretic Mobility Shift Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
MAAAEPASSGQQAPAGQGQGQRPPPQPPQAQAPQPPPPPQLGGAGGGSSRHEKSLGLLTT
KFVSLLQEAKDGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAG CNTKEVIDRLRYLKAEIEDLELKERELDQQKLWLQQSIKNVMDDSINNRFSYVTHEDICN CFNGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLINKESSSSKPVV FPVPPPDDLTQPSSQSLTPVTPQKSSMATQNLPEQHVSERSQALQQTSATDISSAGSISG DIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Cyclins | [+] 1 Cyclins Co-regulated By This TF | + | |||
| 1 | Cyclin A2 (CCNA2) | Literature-reported Target | Target Info | [1] | |
| TF Name | cAMP-dependent transcription factor 1 (ATF-1) homodimer | ||||
| Classification | Superclass | Basic Domains | |||
| Class | Leucine zipper factors (bZIP) | ||||
| Family | CREB | ||||
| Evidence Score (E-score) | 1 | + | |||
| 1 | DNase I Footprint Analysis, Electrophoretic Mobility Shift Assay | [2] | |||
| UniProt ID | |||||
| Sequence |
MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR
RPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQL ASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQ IRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKC LENRVAVLENQNKTLIEELKTLKDLYSNKSV |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Cyclins | [+] 2 Cyclins Co-regulated By This TF | + | |||
| 1 | Cyclin A2 (CCNA2) | Literature-reported Target | Target Info | [2] | |
| 2 | Proliferating cell nuclear antigen (PCNA) | Clinical trial Target | Target Info | [4] | |
| Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
| 1 | Interferon-gamma (IFNG) | Successful Target | Target Info | [5] | |
| Growth factors | [+] 1 Growth factors Co-regulated By This TF | + | |||
| 1 | Transforming growth factor beta 2 (TGFB2) | Clinical trial Target | Target Info | [6] | |
| Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
| 1 | Erythropoietin (EPO) | Clinical trial Target | Target Info | [7] | |
| Lipoprotein receptors | [+] 1 Lipoprotein receptors Co-regulated By This TF | + | |||
| 1 | Low-density lipoprotein receptor (LDL-R) | Successful Target | Target Info | [8] | |
| TF Name | E2F-4/p107 (E2F4/RBL1) heterodimer | ||||
| Classification | Superclass | Helix-turn-helix | |||
| Class | Fork head / winged helix | ||||
| Regulation Mechanism | Cell cycle regulation of the cyclin A gene promoter is mediated by a variant E2F site. | [1] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYD
ITNVLEGIGLIEKKSKNSIQWKGVGPGCNTREIADKLIELKAEIEELQQREQELDQHKVW VQQSIRNVTEDVQNSCLAYVTHEDICRCFAGDTLLAIRAPSGTSLEVPIPEGLNGQKKYQ IHLKSVSGPIEVLLVNKEAWSSPPVAVPVPPPEDLLQSPSAVSTPPPLPKPALAQSQEAS RPNSPQLTPTAVPGSAEVQGMAGPAAEITVSGGPGTDSKDSGELSSLPLGPTTLDTRPLQ SSALLDSSSSSSSSSSSSSNSNSSSSSGPNPSTSFEPIKADPTGVLELPKELSEIFDPTR ECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Cyclins | [+] 1 Cyclins Co-regulated By This TF | + | |||
| 1 | Cyclin A2 (CCNA2) | Literature-reported Target | Target Info | [1] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | Cell cycle regulation of the cyclin A gene promoter is mediated by a variant E2F site. Proc Natl Acad Sci U S A. 1995 Nov 21;92(24):11264-8. | ||||
| REF 2 | Down-regulation of the cyclin A promoter in differentiating human embryonal carcinoma cells is mediated by depletion of ATF-1 and ATF-2 in the complex at the ATF/CRE site. Exp Cell Res. 1995 Feb;216(2):422-30. | ||||
| REF 3 | Down-regulation of the cyclin A promoter by transforming growth factor-beta1 is associated with a reduction in phosphorylated activating transcript... J Biol Chem. 1997 Aug 29;272(35):22259-64. | ||||
| REF 4 | Transcription factors RFX1/EF-C and ATF-1 associate with the adenovirus E1A-responsive element of the human proliferating cell nuclear antigen promoter. Nucleic Acids Res. 1995 Sep 25;23(18):3732-41. | ||||
| REF 5 | The proximal regulatory element of the interferon-gamma promoter mediates selective expression in T cells. J Biol Chem. 1996 Dec 13;271(50):31964-72. | ||||
| REF 6 | Retinoblastoma gene product activates expression of the human TGF-beta 2 gene through transcription factor ATF-2. Nature. 1992 Jul 23;358(6384):331-4. | ||||
| REF 7 | The transcription factors ATF-1 and CREB-1 bind constitutively to the hypoxia-inducible factor-1 (HIF-1) DNA recognition site. Nucleic Acids Res. 1995 Nov 25;23(22):4542-50. | ||||
| REF 8 | Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.