Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T00239 | Target Info | |||
Target Name | Interleukin-4 (IL4) | ||||
Synonyms | Pitrakinra; Lymphocyte stimulatory factor 1; IL-4; Binetrakin; BSF-1; B-cell stimulatory factor 1 | ||||
Target Type | Clinical trial Target | ||||
Gene Name | IL4 | ||||
Biochemical Class | Cytokine: interleukin | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | Nuclear transcription factor Y A/B/C (NF-Y) heterotrimer | ||||
Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
Class | Heteromeric CCAAT factors | ||||
Family | Heteromeric CCAAT factors | ||||
Evidence Score (E-score) | 2 | + | |||
1 | Electrophoretic Mobility Shift Assay | [1] | |||
2 | Electrophoretic Mobility Shift Assay | [3] | |||
UniProt ID | |||||
Sequence |
MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPL
MVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAV QVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTIL QQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMV PGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLH ESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [5] | |
Coagulation factors | [+] 1 Coagulation factors Co-regulated By This TF | + | |||
1 | Coagulation factor VIII (F8) | Successful Target | Target Info | [6] | |
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Apoptosis mediating surface antigen FAS (FAS) | Clinical trial Target | Target Info | [7] | |
2 | Interleukin-4 (IL4) | Clinical trial Target | Target Info | [1] | |
Ester hydrolases | [+] 1 Ester hydrolases Co-regulated By This TF | + | |||
1 | M-phase inducer phosphatase 3 (MPIP3) | Literature-reported Target | Target Info | [8] | |
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
1 | Catalase (CAT) | Clinical trial Target | Target Info | [9] | |
TF Name | Nuclear factor of activated T-cells 1 (NF-ATc1) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | diverse Cys4 zinc fingers | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | The activation of human IL4 transcription through the Ca(2+)-dependent pathway is diminished by protein kinase C stimulation in Jurkat T cells. This phenomenon is due to mutually exclusive binding ofNF-ATp andNF-kappa B to the P sequence, an element located 69 bp upstream of theIL4 transcription initiation site. | [2] | |||
Evidence Score (E-score) | 2 | + | |||
1 | Electrophoretic Mobility Shift Assay | [2] | |||
2 | Electrophoretic Mobility Shift Assay, Methylation Interference Assay | [4] | |||
UniProt ID | |||||
Sequence |
MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPT
AHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRI EITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSR SCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPST SPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSW LGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSP PPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLP SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGT ADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLR NSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEK QSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEI PPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQ GLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGV ASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEH SLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHE DGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Interleukin-4 (IL4) | Clinical trial Target | Target Info | [2] | |
2 | Interleukin-5 (IL5) | Successful Target | Target Info | [10] | |
TF Name | Nuclear factor of activated T-cells 2 (NF-ATc2) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | diverse Cys4 zinc fingers | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | The activation of human IL4 transcription through the Ca(2+)-dependent pathway is diminished by protein kinase C stimulation in Jurkat T cells. This phenomenon is due to mutually exclusive binding ofNF-ATp andNF-kappa B to the P sequence, an element located 69 bp upstream of theIL4 transcription initiation site. | [2] | |||
Evidence Score (E-score) | 2 | + | |||
1 | Electrophoretic Mobility Shift Assay | [2] | |||
2 | Electrophoretic Mobility Shift Assay, Methylation Interference Assay | [4] | |||
UniProt ID | |||||
Sequence |
MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAY
PDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHE LIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFIS DTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPR PASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGS AVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGER RNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH RAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRIT GKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNT RVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTG QNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYV INGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSC LVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADA HRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG TTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNL DQTYLDDVNEIIRKEFSGPPARNQT |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Interleukin-4 (IL4) | Clinical trial Target | Target Info | [2] | |
2 | Interleukin-5 (IL5) | Successful Target | Target Info | [10] | |
TF Name | NF-kappa-B p65-p65 (NFKB) homodimer | ||||
Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
Class | RHR (Rel homology region) | ||||
Family | Rel/ankyrin | ||||
Regulation Type | Decrease | ||||
Regulation Mechanism | HumanIL4 promoter-mediated transcription is downregulated in Jurkat cells stimulated with theNFKB-activating cytokine tumor necrosis factor alpha and suppressed in RelA-overexpressing cells. | [2] | |||
Evidence Score (E-score) | 1 | + | |||
1 | Electrophoretic Mobility Shift Assay | [2] | |||
UniProt ID | |||||
Sequence |
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM DFSALLSQISS |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
1 | Apolipoprotein C-III (ApoCIII) | Clinical trial Target | Target Info | [11] | |
Cytokines / Cytokine receptors | [+] 3 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Interleukin-1 beta (IL1B) | Successful Target | Target Info | [12] | |
2 | Interleukin-12 beta (IL12B) | Successful Target | Target Info | [13] | |
3 | Interleukin-4 (IL4) | Clinical trial Target | Target Info | [2] | |
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
1 | Intercellular adhesion molecule ICAM-1 (ICAM1) | Successful Target | Target Info | [14] | |
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
1 | Arachidonate 12-lipoxygenase (12-LOX) | Literature-reported Target | Target Info | [15] | |
Transcription factors | [+] 2 Transcription factors Co-regulated By This TF | + | |||
1 | Cellular tumor antigen p53 (TP53) | Clinical trial Target | Target Info | [16] | |
2 | Interferon regulatory factor 1 (IRF1) | Literature-reported Target | Target Info | [17] | |
TF Name | NF-kappa-B (NFKB) homo/heterodimer | ||||
Classification | Superclass | beta-Scaffold Factors with Minor Groove Contacts | |||
Class | RHR (Rel homology region) | ||||
Regulation Type | Decrease | ||||
Regulation Mechanism | HumanIL4 promoter-mediated transcription is downregulated in Jurkat cells stimulated with theNFKB-activating cytokine tumor necrosis factor alpha and suppressed in RelA-overexpressing cells. | [2] | |||
Evidence Score (E-score) | 1 | + | |||
1 | Electrophoretic Mobility Shift Assay | [2] | |||
UniProt ID | |||||
Sequence |
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ EGPLEGKI |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 5 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | C-X-C motif chemokine 1 (CXCL1) | Literature-reported Target | Target Info | [18] | |
2 | C-X-C motif chemokine 2 (CXCL2) | Clinical trial Target | Target Info | [19] | |
3 | Interleukin 2 receptor alpha (IL2RA) | Successful Target | Target Info | [20] | |
4 | Interleukin-4 (IL4) | Clinical trial Target | Target Info | [2] | |
5 | Interleukin-8 (IL8) | Successful Target | Target Info | [21] | |
Glycoproteins | [+] 1 Glycoproteins Co-regulated By This TF | + | |||
1 | E-selectin (SELE) | Clinical trial Target | Target Info | [22] | |
Immunoglobulins | [+] 1 Immunoglobulins Co-regulated By This TF | + | |||
1 | Intercellular adhesion molecule ICAM-1 (ICAM1) | Successful Target | Target Info | [14] | |
Transcription factors | [+] 1 Transcription factors Co-regulated By This TF | + | |||
1 | Cellular tumor antigen p53 (TP53) | Clinical trial Target | Target Info | [23] | |
TF Name | Interferon regulatory factor 2 (IRF2) | ||||
Classification | Superclass | Helix-turn-helix | |||
Class | Tryptophan clusters | ||||
Family | Interferon-regulating factors | ||||
Evidence Score (E-score) | 1 | + | |||
1 | Electrophoretic Mobility Shift Assay | [1] | |||
UniProt ID | |||||
Sequence |
MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAI
HTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSK KGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQ SHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVP SDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVP YNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
CD antigens | [+] 1 CD antigens Co-regulated By This TF | + | |||
1 | Vascular cell adhesion protein 1 (VCAM1) | Literature-reported Target | Target Info | [24] | |
Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Interleukin-4 (IL4) | Clinical trial Target | Target Info | [1] | |
TF Name | C/EBP gamma (CEBPG) homodimer | ||||
Classification | Superclass | Basic Domains | |||
Class | Leucine zipper factors (bZIP) | ||||
Family | C/EBP-like factors | ||||
Regulation Type | Increase | ||||
Regulation Mechanism | CEBPG binds to the PRE-I (positive regulatory element-I), whichis a strong enhancer element essential for expression of the human IL4-encoding gene. | [1] | |||
Evidence Score (E-score) | 1 | + | |||
1 | Electrophoretic Mobility Shift Assay | [1] | |||
UniProt ID | |||||
Sequence |
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDR
NSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKD LFLEHAHNLADNVQSISTENTTADGDNAGQ |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
1 | Interleukin-4 (IL4) | Clinical trial Target | Target Info | [1] |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Cloning of the cDNA encoding human C/EBP gamma, a protein binding to the PRE-I enhancer element of the human interleukin-4 promoter. Gene. 1995 Aug 19;161(2):271-5. | ||||
REF 2 | Inhibition of NF-AT-dependent transcription by NF-kappa B: implications for differential gene expression in T helper cell subsets. Proc Natl Acad Sci U S A. 1995 Dec 5;92(25):11623-7. | ||||
REF 3 | The role of NF-Y and IRF-2 in the regulation of human IL-4 gene expression. J Immunol. 1994 Nov 1;153(9):4122-33. | ||||
REF 4 | Characterization of constitutive and inducible transcription factors binding to the P2 NF-AT site in the human interleukin-4 promoter. Gene. 1997 Apr 1;188(2):253-60. | ||||
REF 5 | NFY transcription factor binds to regulatory element AIC and transactivates the human apolipoprotein A-I promoter in HEPG2 cells. Biochem Biophys Res Commun. 1997 Feb 3;231(1):140-3. | ||||
REF 6 | Role of the liver-enriched transcription factor hepatocyte nuclear factor 1 in transcriptional regulation of the factor V111 gene. Mol Cell Biol. 1996 May;16(5):1936-45. | ||||
REF 7 | Identification of thyroid hormone response elements in the human fatty acid synthase promoter. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12260-5. | ||||
REF 8 | Cell cycle regulation of cdc25C transcription is mediated by the periodic repression of the glutamine-rich activators NF-Y and Sp1. Nucleic Acids Res. 1995 Oct 11;23(19):3822-30. | ||||
REF 9 | Regulation of the catalase gene promoter by Sp1, CCAAT-recognizing factors, and a WT1/Egr-related factor in hydrogen peroxide-resistant HP100 cells. Cancer Res. 2001 Aug 1;61(15):5885-94. | ||||
REF 10 | A nuclear factor of activated T cell-like transcription factor in mast cells is involved in IL-5 gene regulation after IgE plus antigen stimulation. J Immunol. 1995 Jun 1;154(11):6112-9. | ||||
REF 11 | Apo CIII gene transcription is regulated by a cytokine inducible NF-kappa B element. Nucleic Acids Res. 1994 Jun 25;22(12):2417-22. | ||||
REF 12 | Characterization of a functional NF-kappa B site in the human interleukin 1 beta promoter: evidence for a positive autoregulatory loop. Mol Cell Biol. 1993 Oct;13(10):6231-40. | ||||
REF 13 | Inhibition of IL-12 production by 1,25-dihydroxyvitamin D3. Involvement of NF-kappaB downregulation in transcriptional repression of the p40 gene. J Clin Invest. 1998 Jan 1;101(1):252-62. | ||||
REF 14 | Flanking sequences for the human intercellular adhesion molecule-1 NF-kappaB response element are necessary for tumor necrosis factor alpha-induced gene expression. J Biol Chem. 1997 Jun 20;272(25):15928-35. | ||||
REF 15 | The transcriptional regulation of human arachidonate 12-lipoxygenase gene by NF kappa B/Rel. FEBS Lett. 1995 Apr 17;363(1-2):105-10. | ||||
REF 16 | Expression of human p53 requires synergistic activation of transcription from the p53 promoter by AP-1, NF-kappaB and Myc/Max. Oncogene. 1999 Apr 29;18(17):2728-38. | ||||
REF 17 | Synergy between interferon-gamma and tumor necrosis factor-alpha in transcriptional activation is mediated by cooperation between signal transducer and activator of transcription 1 and nuclear factor kappaB. J Biol Chem. 1997 Jun 6;272(23):14899-907. | ||||
REF 18 | HMGI(Y) and Sp1 in addition to NF-kappa B regulate transcription of the MGSA/GRO alpha gene. Nucleic Acids Res. 1995 Oct 25;23(20):4210-9. | ||||
REF 19 | An NF-kappa B-like transcription factor mediates IL-1/TNF-alpha induction of gro in human fibroblasts. J Immunol. 1991 Jul 15;147(2):520-7. | ||||
REF 20 | Regulation of cell-type-specific interleukin-2 receptor alpha-chain gene expression: potential role of physical interactions between Elf-1, HMG-I(Y... Mol Cell Biol. 1995 Mar;15(3):1786-96. | ||||
REF 21 | Cooperation between transcription factor AP-1 and NF-kappaB in the induction of interleukin-8 in human pancreatic adenocarcinoma cells by hypoxia. J Interferon Cytokine Res. 1999 Dec;19(12):1363-71. | ||||
REF 22 | Interleukin-4 suppression of tumor necrosis factor alpha-stimulated E-selectin gene transcription is mediated by STAT6 antagonism of NF-kappaB. J Biol Chem. 1997 Apr 11;272(15):10212-9. | ||||
REF 23 | Additive effect between NF-kappaB subunits and p53 protein for transcriptional activation of human p53 promoter. Oncogene. 2000 Sep 28;19(41):4787-94. | ||||
REF 24 | Interferon regulatory factor-2 is a transcriptional activator in muscle where It regulates expression of vascular cell adhesion molecule-1. J Cell Biol. 1998 Mar 9;140(5):1265-76. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.