Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T64410
|
||||
| Former ID |
TTDS00182
|
||||
| Target Name |
D-alanyl-D-alanine carboxypeptidase
|
||||
| Gene Name |
vanYB
|
||||
| Synonyms |
D-alanyl-D-alanine carboxypeptidase-transpeptidase; DD-carboxypeptidase; DD-peptidase; vanYB
|
||||
| Target Type |
Successful
|
||||
| Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
| Gram-positive bacterial infection [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104] | |||||
| Function |
Vancomycin-inducible, penicillin-resistant, DD- carboxypeptidase that hydrolyzes depsipeptide- and D-alanyl-D- alanine-containing peptidoglycan precursors. Insensitive to beta- lactams.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T64410
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.16.4
|
||||
| Sequence |
MEKSNYHSNVNHHKRHMKQSGEKRAFLWAFIISFTVCTLFLGWRLVSVLEATQLPPIPAT
HTGSGTGVAENPEENTLATAKEQGDEQEWSLILVNRQNPIPAQYDVELEQLSNGERIDIR ISPYLQDLFDAARADGVYPIVASGYRTTEKQQEIMDEKVAEYKAKGYTSAQAKAEAETWV AVPGTSEHQLGLAVDINADGIHSTGNEVYRWLDENSYRFGFIRRYPPDKTEITGVSNEPW HYRYVGIEAATKIYHQGLCLEEYLNTEK |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | B-Lactams | Drug Info | Approved | Bacterial infections | [1] |
| Cefalotin | Drug Info | Approved | Bacterial infections | [2] | |
| Cefotaxime | Drug Info | Approved | Bacterial infections | [3] | |
| Cephalosporin | Drug Info | Approved | Bacterial infections | [4] | |
| TD-1792 | Drug Info | Phase 2 | Gram-positive bacterial infection | [5] | |
| Inhibitor | 2-[(Dioxidophosphino)Oxy]Benzoate | Drug Info | [6] | ||
| 3-boronobenzoic acid | Drug Info | [7] | |||
| 5-boronothiophene-2-carboxylic acid | Drug Info | [7] | |||
| B-Lactams | Drug Info | [1] | |||
| Benzo[c][1,2]oxaborol-1(3H)-ol | Drug Info | [7] | |||
| Cefalotin | Drug Info | [8] | |||
| Cefotaxime | Drug Info | [9], [8] | |||
| Cephalosporin C | Drug Info | [10] | |||
| D-Alanine | Drug Info | [6] | |||
| Formaldehyde | Drug Info | [6] | |||
| Glycyl-L-Alpha-Amino-Epsilon-Pimelyl-D-Alanine | Drug Info | [6] | |||
| NITROCEFIN | Drug Info | [11] | |||
| Phenyl Boronic acid | Drug Info | [7] | |||
| TD-1792 | Drug Info | [12] | |||
| Binder | Cephalosporin | Drug Info | [13] | ||
| References | |||||
| REF 1 | Has nature already identified all useful antibacterial targets? Curr Opin Microbiol. 2008 Oct;11(5):387-92. Epub 2008 Oct 6. | ||||
| REF 2 | Cefalotin - FDA approved drug information (drug label) from DailyMed. | ||||
| REF 3 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 064200. | ||||
| REF 4 | The Cephalosporin Antimicrobial Agents: A Comprehensive Review. J Vet Pharmacol Ther 11 (1):1-32. 1988. | ||||
| REF 5 | ClinicalTrials.gov (NCT00442832) TD-1792 in Gram-positive Complicated Skin and Skin Structure Infection. U.S. National Institutes of Health. | ||||
| REF 6 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
| REF 7 | J Med Chem. 2009 Oct 8;52(19):6097-106.Synthesis and evaluation of 3-(dihydroxyboryl)benzoic acids as D,D-carboxypeptidase R39 inhibitors. | ||||
| REF 8 | Binding of cephalothin and cefotaxime to D-ala-D-ala-peptidase reveals a functional basis of a natural mutation in a low-affinity penicillin-binding protein and in extended-spectrum beta-lactamases. Biochemistry. 1995 Jul 25;34(29):9532-40. | ||||
| REF 9 | Extended-spectrum cephalosporinases: structure, detection and epidemiology. Future Microbiol. 2007 Jun;2:297-307. | ||||
| REF 10 | DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-4. Nucleic Acids Res. 2011 January | ||||
| REF 11 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. | ||||
| REF 12 | How many modes of action should an antibiotic have? Curr Opin Pharmacol. 2008 Oct;8(5):564-73. Epub 2008 Jul 30. | ||||
| REF 13 | A 1.2-A snapshot of the final step of bacterial cell wall biosynthesis. Proc Natl Acad Sci U S A. 2001 Feb 13;98(4):1427-31. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.