Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T54229
|
||||
Former ID |
TTDR00240
|
||||
Target Name |
Angiogenin
|
||||
Gene Name |
ANG
|
||||
Synonyms |
RNase 5; Ribonuclease 5; ANG
|
||||
Target Type |
Research
|
||||
Function |
Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo.
|
||||
BioChemical Class |
Endoribonucleases
|
||||
UniProt ID | |||||
EC Number |
EC 3.1.27.-
|
||||
Sequence |
MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLT
SPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRA TAGFRNVVVACENGLPVHLDQSIFRRP |
||||
Inhibitor | Pyroglutamic Acid | Drug Info | [1] | ||
Pyrophosphate 2- | Drug Info | [2] | |||
Pathways | |||||
NetPath Pathway | IL2 Signaling Pathway | ||||
TGF_beta_Receptor Signaling Pathway | |||||
Reactome | Adherens junctions interactions | ||||
References | |||||
REF 1 | How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | ||||
REF 2 | The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.