Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T53024
|
||||
Former ID |
TTDS00394
|
||||
Target Name |
Somatostatin receptor type 2
|
||||
Gene Name |
SSTR2
|
||||
Synonyms |
SRIF-1; SS2R; Somatostatin receptor 2; Sst(2); SSTR2
|
||||
Target Type |
Successful
|
||||
Disease | Acromegaly [ICD9: 253; ICD10: E22.0] | ||||
Alzheimer disease [ICD9: 331; ICD10: G30] | |||||
Cushing's disease [ICD9: 255; ICD10: E24.0] | |||||
Lung cancer [ICD9: 162; ICD10: C33-C34] | |||||
Neuroendocrine cancer [ICD10: C7A] | |||||
Function |
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T53024
|
||||
UniProt ID | |||||
Sequence |
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL LNGDLQTSI |
||||
Drugs and Mode of Action | |||||
Drug(s) | Lanreotide acetate | Drug Info | Approved | Acromegaly | [1], [2] |
Lanreotide Autogel | Drug Info | Approved | Acromegaly | [3] | |
Octreotide | Drug Info | Approved | Acromegaly | [4], [5] | |
Pasireotide | Drug Info | Approved | Cushing's disease | [6], [7] | |
ODT-8 | Drug Info | Phase 3 | Discovery agent | [8] | |
Re-188-P-2045 | Drug Info | Phase 1/2 | Lung cancer | [9] | |
FR-121196 | Drug Info | Terminated | Alzheimer disease | [10] | |
Antagonist | 98mTC-CIM-ANT | Drug Info | [11] | ||
Modulator | 99mTc-MIP-1407 | Drug Info | [11] | ||
FR-121196 | Drug Info | [12] | |||
Lanreotide acetate | Drug Info | [1] | |||
Re-188-P-2045 | Drug Info | [9] | |||
Inhibitor | Ala11-SRIF-14-amide | Drug Info | [13] | ||
Ala6-SRIF-14-amide | Drug Info | [13] | |||
Ala7-SRIF-14-amide | Drug Info | [13] | |||
CytotoxinPeptide Conjugate | Drug Info | [14] | |||
D-Phe-c[Cys-Tyr-D-Trp-Lys-Val-Cys]-Asp-NH2 | Drug Info | [15] | |||
Des-AA1,2,4,12,13-[D-Trp8]SRIF | Drug Info | [16] | |||
Des-AA1,2,4,13-[D-Trp8]SRIF | Drug Info | [16] | |||
Des-AA1,2,4,5,11,12,13-[D-Trp8]SRIF | Drug Info | [16] | |||
Des-AA1,2,4,5,13-[D-Trp8]-SRIF | Drug Info | [16] | |||
Des-AA1,2,4,5,6,12,13-[D-Trp8]SRIF | Drug Info | [16] | |||
Des-AA1,2,4,5-[D-Trp8]SRIF | Drug Info | [16] | |||
Des-AA1,2,5,12,13-[D-Trp8]SRIF | Drug Info | [16] | |||
Des-AA1,2,5-[D-Trp8,Tyr11]SRIF | Drug Info | [17] | |||
Des-AA5-[D-Trp8]SRIF | Drug Info | [17] | |||
H-c[Cys-Phe-DTrp-Lys-Thr-Cys]-OH | Drug Info | [18] | |||
H-D-Phe-Cys-Tyr-D-Trp-Lys-Val-Cys-Thr-NH2 | Drug Info | [15] | |||
H-D-Phe-c[Cys-Ala-D-Trp-Lys-Thr-Cys]-Thr-NH2 | Drug Info | [18] | |||
H-DPhe-c[Cys-Phe-DTrp-Lys-Thr-Cys]-Thr-NH2 | Drug Info | [18] | |||
ODT-8 | Drug Info | [16] | |||
Pasireotide | Drug Info | [11] | |||
Pyz11-D-Trp8-SRIF | Drug Info | [13] | |||
Pyz6-D-Trp8-SRIF | Drug Info | [13] | |||
Radiolabeled octreotide derivative | Drug Info | [19] | |||
SOMATOSTATIN | Drug Info | [15] | |||
SRIF-28 | Drug Info | [20] | |||
Agonist | CGP 23996 | Drug Info | [21] | ||
L-054,522 | Drug Info | [22] | |||
L-054852 | Drug Info | [3] | |||
L-779,976 | Drug Info | [23] | |||
SRIF-14 | Drug Info | [21] | |||
Binder | Lanreotide Autogel | Drug Info | [3] | ||
Octreotide | Drug Info | [24] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | cAMP signaling pathway | ||||
Neuroactive ligand-receptor interaction | |||||
Gastric acid secretion | |||||
PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
Reactome | Peptide ligand-binding receptors | ||||
G alpha (i) signalling events | |||||
WikiPathways | SIDS Susceptibility Pathways | ||||
GPCRs, Class A Rhodopsin-like | |||||
Peptide GPCRs | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
GPCRs, Other | |||||
References | |||||
REF 1 | Pasireotide, a multi-somatostatin receptor ligand with potential efficacy for treatment of pituitary and neuroendocrine tumors. Drugs Today (Barc). 2013 Feb;49(2):89-103. | ||||
REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2031). | ||||
REF 3 | Treatment strategies for acromegaly. Expert Opin Emerg Drugs. 2005 Nov;10(4):875-90. | ||||
REF 4 | Emerging drugs for complications of end-stage liver disease. Expert Opin Emerg Drugs. 2008 Mar;13(1):159-74. | ||||
REF 5 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2055). | ||||
REF 6 | ClinicalTrials.gov (NCT02527993) Treatment of Hypoglycemia Following Gastric Bypass Surgery. | ||||
REF 7 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 8 | ClinicalTrials.gov (NCT01220167) Three-way Crossover Comparative Water-effect Bioavailability to Compare Ondansetron ODFS 8mg With and Without Water With Zofran ODT 8mg Without Water in 18 Healthy Participants Under Fasting Conditions. U.S. National Institutes of Health. | ||||
REF 9 | The somatostatin analog 188Re-P2045 inhibits the growth of AR42J pancreatic tumor xenografts. J Nucl Med. 2014 Dec;55(12):2020-5. | ||||
REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001380) | ||||
REF 11 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 356). | ||||
REF 12 | Role of somatostatin in the augmentation of hippocampal long-term potentiation by FR121196, a putative cognitive enhancer. Eur J Pharmacol. 1993 Sep 7;241(1):27-34. | ||||
REF 13 | J Med Chem. 2005 Jun 16;48(12):4025-30.Replacement of Phe6, Phe7, and Phe11 of D-Trp8-somatostatin-14 with L-pyrazinylalanine. Predicted and observed effects on binding affinities at hSST2 and hSST4.An unexpected effect of the chirality of Trp8 on NMR spectra in methanol. | ||||
REF 14 | Bioorg Med Chem Lett. 2003 Mar 10;13(5):799-803.An adjustable release rate linking strategy for cytotoxin-peptide conjugates. | ||||
REF 15 | J Med Chem. 2005 Oct 20;48(21):6643-52.Discovery of iodinated somatostatin analogues selective for hsst2 and hsst5 with excellent inhibition of growth hormone and prolactin release from rat pituitarycells. | ||||
REF 16 | J Med Chem. 2005 Jan 27;48(2):515-22.Somatostatin receptor 1 selective analogues: 3. Dicyclic peptides. | ||||
REF 17 | J Med Chem. 2005 Jan 27;48(2):507-14.Somatostatin receptor 1 selective analogues: 2. N(alpha)-Methylated scan. | ||||
REF 18 | J Med Chem. 2006 Jul 27;49(15):4487-96.Novel sst2-selective somatostatin agonists. Three-dimensional consensus structure by NMR. | ||||
REF 19 | J Med Chem. 2005 Apr 21;48(8):2778-89.N-terminal sugar conjugation and C-terminal Thr-for-Thr(ol) exchange in radioiodinated Tyr3-octreotide: effect on cellular ligand trafficking in vitro and tumor accumulation in vivo. | ||||
REF 20 | J Med Chem. 2010 Aug 26;53(16):6188-97.Novel octreotide dicarba-analogues with high affinity and different selectivity for somatostatin receptors. | ||||
REF 21 | [125I][Tyr3]octreotide labels human somatostatin sst2 and sst5 receptors. Eur J Pharmacol. 1998 May 8;348(2-3):311-20. | ||||
REF 22 | Synthesis and biological activities of potent peptidomimetics selective for somatostatin receptor subtype 2. Proc Natl Acad Sci U S A. 1998 Sep 1;95(18):10836-41. | ||||
REF 23 | Rapid identification of subtype-selective agonists of the somatostatin receptor through combinatorial chemistry. Science. 1998 Oct 23;282(5389):737-40. | ||||
REF 24 | Versatile conjugation of octreotide to dendrimers by cycloaddition ("click") chemistry to yield high-affinity multivalent cyclic Peptide dendrimers. Bioconjug Chem. 2009 Jul;20(7):1323-31. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.